SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015477053.1.82291 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015477053.1.82291
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2190-2306
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-37
Family Pleckstrin-homology domain (PH domain) 0.00000304
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 1011-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 8.14e-30
Family Spectrin repeat 0.0000235
Further Details:      
 
Domain Number 5 Region: 1539-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-30
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 6 Region: 1646-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 9.48e-30
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 7 Region: 641-744
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-28
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 8 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 3.22e-28
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 9 Region: 1858-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 739-856
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-24
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 11 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 529-638
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 13 Region: 851-952
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-18
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 14 Region: 1384-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 7.49e-18
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 15 Region: 1993-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000196
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015477053.1.82291
Sequence length 2360
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X1 [Parus major]; AA=GCF_001522545.2; RF=representative genome; TAX=9157; STAX=9157; NAME=Parus major; AL=Chromosome; RT=Major
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVAKELETENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEA
GYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQ
ILSSDDYGKDLTSVVRLLSKHKAFEDEMSGRSGHFQQAIKEGEDMIAEEHFGSEKIRERI
KDIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYST
QSLVKKHKDVAEEIASYRPTIDSLHEQAKALPQEHAESPDVQGRLSGIEERYKEVAELTR
LRKQALQDTLALYKMFSEADACELWIDEKEKWLNNMQIPEKLEDLEVIQHRFESLEPEMN
NQASRVAVVNQIARQLMHSGHPGEKIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEINDVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDDRHRKN
REAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLEKIEKEGMQLIAEKPETEAVVKEKLTGLHQMWDELESTTQTKAQRLFDAN
KAELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEIEELQ
SQARALSQEGKSTDEVDGKRLTVEKKFLELLEPLNERKANLLASKEIHQFNRDVEDEILW
VGERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITESSPNAE
VIQQRLADLKQLWNLLIEETEKRHKRLEESHRAQQYYFDAAEAEAWMSEQELYMMSEEKA
KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRTLVADNHPESERISMRQSKVDKLYA
GLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR
EFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQIL
AASYELHKFYHDAKEILGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVR
QLQEDAARLQAAYAGDKADDIQKRENEVLEAWKALLDACEGRRVRLVDTGDKFRFFSMVR
DLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARK
HYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLS
SREIGQSVDEVEKLIKRHEAFEKSAATWDERFAALERLTTLELLEVRRQQEEEERKRQPP
TPEPKVAEDGDSQQQWDGTKGEQVSQNGLPSDQESPRVAETAETNEMVNGAAEQRTSSKE
SSPVPSPTSDRKAKGGVQAQTAATLPAKTQEIPSAQMEGFLHRKHEWETHSKKASSRSWH
NVYCVINNQEMGFYKDSKAAASGIPYHNEIPVSLKDAVCEVAVDYKKKKHVFKLRLTDGN
EYLFQAKDDEEMNTWIQAITSAISSDKIEVSPTTQSTPASSRAQTLPASVTITSESSPGK
REKDKEKDKEKRFSLFGKKK
Download sequence
Identical sequences XP_015477053.1.82291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]