SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015618760.1.37577 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015618760.1.37577
Domain Number 1 Region: 31-290
Classification Level Classification E-value
Superfamily L domain-like 9.23e-53
Family Polygalacturonase inhibiting protein PGIP 0.00026
Further Details:      
 
Domain Number 2 Region: 443-599,626-687,732-779
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-51
Family Protein kinases, catalytic subunit 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015618760.1.37577
Sequence length 785
Comment PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 [Oryza sativa Japonica Group]; AA=GCF_001433935.1; RF=representative genome; TAX=39947; STAX=4530; NAME=Oryza sativa Japonica Group; AL=Chromosome; RT=Major
Sequence
MTTLPTAILLLLLLLALPPPSAVVALTADGLALLALKAAVTDDPLSVLSSWSESDPDPCR
WPGVTCSNVTAAGGEPRRRVVGVALAGKNLSGYIPSELGSLLFLRRLNLHDNRLAGGVPA
ALSNASSLHSLFLYGNRLTGALPAALCDIPRLQNLDVSRNALSGGLPGDLRNCRSLQRLI
LAGNSFSGEVPAGIWAEMASLQQLDISSNGFNGSIPADLGELPRLAGTLNLSHNRFSGVV
PPELGRLPATVTLDLRFNNLSGAIPQTGSLASQGPTSFLNNPGLCGFPLQVPCRAVPPPT
QSPPAPTTTTTTTTPSSASAAAAAASEHHQPIRTSLIALISIADAAGVALVGVILVYVYW
KVKDRKKQGRSSTVAAGDENESRHGLCRCIWGHRGVDSDTDTDDSSASENGGGGGKYGEG
ELVAIDRGFRVELDELLRSSAYVLGKGGKGIVYKVVVGNGATPVAVRRLGGGGGGGERCK
EFAAEARAVGRARHPNVVRLRAYYWSADEKLVVTDFVGNGNLAAAMRGRPGQTPLSWSTR
LKIARGAARGLAYLHECSPRRFVHGEVKPSNILLDADFTPRVADFGLARLLAVAGCADDV
VDAPPAAPSSGGLLGGAIPYAAKPASSVAADHRGGGYRAPEARTAGARPAQKWDVFSFGV
VLMELLTGRGPGDHASPSTSASFSAPSSSSAATTDRSGSGEHGHGAGVGGAVVPEVVRWV
RRGFEEEARPVSEMVDPALLRDAPPLPKKEVVAAFHLALACTELDADLRPRMKAVADTLD
KIASS
Download sequence
Identical sequences A0A0E0RFD3 A0A0P0Y8G5
39947.LOC_Os12g13300.1 XP_015618760.1.37577 LOC_Os12g13300.1|13112.m01411|protein LOC_Os12g13300.1|PACid:21934232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]