SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015669178.1.16292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015669178.1.16292
Domain Number 1 Region: 14-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-92
Family Calponin-homology domain, CH-domain 0.000000733
Further Details:      
 
Domain Number 2 Region: 2188-2304
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-38
Family Pleckstrin-homology domain (PH domain) 0.00000308
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-35
Family Spectrin repeat 0.0000537
Further Details:      
 
Domain Number 4 Region: 639-743
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-28
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 1011-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-28
Family Spectrin repeat 0.0000243
Further Details:      
 
Domain Number 6 Region: 1539-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-28
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 7 Region: 1646-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-28
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 8 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 6.35e-28
Family Spectrin repeat 0.00057
Further Details:      
 
Domain Number 9 Region: 1858-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 2.19e-27
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 10 Region: 819-951
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-25
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 11 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-23
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 12 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-21
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 13 Region: 746-847
Classification Level Classification E-value
Superfamily Spectrin repeat 1.47e-20
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 14 Region: 1384-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-18
Family Spectrin repeat 0.00047
Further Details:      
 
Domain Number 15 Region: 1986-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015669178.1.16292
Sequence length 2354
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 [Protobothrops mucrosquamatus]; AA=GCF_001527695.2; RF=representative genome; TAX=103944; STAX=103944; NAME=Protobothrops mucrosquamatus; AL=Scaffold; RT=Minor
Sequence
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVAKELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLSALRRARLEESRRLWKFFWEMAEEEGWIREKEQI
LSSDDYGKDLTSIVRLLSKHKAFEDEMSGRSGHFQQAVKEGEDMITENHFGSEKIRERIS
DIQNQWANLEQLSSIRKKRLEEASLLHQFQADADDIDTWMLDILKIVSSNDVGHDEYSTQ
SLVKKHKDVAEEIASYRSIIDSLHEQAKALPQEYAESIDVQSRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMEIPEKLEDLEVIQHRFESLEPEMNS
QASRVAVVNQIARQLIHNGHPNEKEIKAQQDKLNTRWSQFRELVDIKKDALISALSIQNY
HLECNETKSWIREKTKVIESTQELGNDLAGVIALQRKLTGMERDLVAIEAKLTDLQKEAE
KLESEHPDQARAILSRLAEINDVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLMEAEKLLTQHENIKNEINNYEEDYQKMRDIGEMVTQGQTDAQYMFL
HQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDKIQEKVDSIDDRHKKN
REVASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELGSNKEWLDKIQKEGMQLIAEKPETEAIVKEKLTSLHQMWQELESTTQTKAQRLFDAN
KAELFTQSCADLDKWLNGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEIEELQ
SQAQALSQEGKSPDEVDGKRYTVEKKFLELLEPLNERKSHLLASKEIHQFNRDVEDEILW
VGERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIHGHQPRIDDIFERSQNILTDSSLNAE
AIQQRLADLQQLWNLLIEETEKRHKRLEESHKAQQYYFDAAEAEAWMSEQELYMMSEEKA
KDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRTLVADNHPESERISMRQSKVDKLYA
GLKDLSEERRGRLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR
EFARDTGNIGQERVDTVNHMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQIL
AASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVR
QLQEDAARLQSAYAGDKADDIQKRENEVLEAWKTLLDACEGRRVRLVDTGDKFRFFSMVR
DLMLWMDDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARK
HYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLS
SREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRQPP
SPEPSPRTGEESQWDGIKGEKVAQNGLSPDQESPRMGEARETNEMVNGAADQRTSSKETS
PVPSPTADRKAKTSLQAQTAATLPAKTQEIPSAQMEGFLNRKHEWESHSKKASNRSWHNV
YCVINNQEMGFYKDAKAASSGIPYHSEIPVSLKEAICEVAVEYKKKKHVFKLRLTDGNEY
LFQAKDEEEMNTWIQAITSAISSDKIELSTSTQSTPASNRAQTLPATVTVTSESSPGKRE
KDKEKRFSLFGKKK
Download sequence
Identical sequences XP_015669178.1.16292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]