SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015670105.1.16292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015670105.1.16292
Domain Number 1 Region: 622-877
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-55
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 2 Region: 11-270
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 321-556
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 4 Region: 925-1185
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-39
Family YWTD domain 0.0000427
Further Details:      
 
Domain Number 5 Region: 879-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000542
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1316-1352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 577-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000002
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 1238-1277
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 1278-1314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 273-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000141
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 11 Region: 1195-1248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000477
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015670105.1.16292
Sequence length 1486
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Protobothrops mucrosquamatus]; AA=GCF_001527695.2; RF=representative genome; TAX=103944; STAX=103944; NAME=Protobothrops mucrosquamatus; AL=Scaffold; RT=Minor
Sequence
MTCFPLSKASPLLLYANRRDLRLVDAADVTENATIVVGGLEDAAALDFVFIRGLIYWSDV
SEEAIKRTEFNRSGSVQNIVISGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRK
VLFWQELDQPRAIALDPPRGFLYWTDWGEMPKIERAGMDGSSRSIIISADIYWPNGLTLD
YEEQKLYWADAKLNFIHRSNLDGTQRQAVIKGSLPHPFALTLFGDTLYWTDWTTRSILAC
NKYTGQNLREIHANIFSPMDIHVFSQQRQPSAPNPCRNNNGGCSHLCLMSPIKPFYQCAC
PTGVKLLENKKTCKEGAMELLLLARRTDLRRISLDTPDFTDIVLELEDIRHAIAIDYDPV
EGYIYWTDDEVRAIRRSFLDGSASQFVVQAQIAHPDGIAVDWVARNLYWTDTGTDRIEVT
RLNGTMRKILISEDLEEPRAIVLDPMIGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLG
WPNGLALDYIENMIYWGDAKTDKIEVMKTDGTSRRVLVEDKLPHIFGFTLLGDYIYWTDW
QRRSIERVHKRTAEREIIIDQLPDLMGLKAINVHKIMGTNPCAESNGGCSHLCLYRPQGL
RCACPIGLELLSDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFD
VTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIE
VSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERSTLVPNV
GRANGLTIDYVKRRLYWTDLDTNLIESSNMLGLDRDVIADDLPHPFGLTQYQDYIYWTDW
SRRSIERANKTSGQNRTIIQNHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVG
GFVCGCPAHYSLNPDNRTCSAPTSFLLFSQKNAINRMVIDGLKSPEIILPIHSLRNVRAI
DYDPLEKQLYWIDSRQNIIRRSQENGSQSFTVVMSPVPNQNPDIQPYDLSIDIYSRYIYW
TCEATNVINVTRLDGRLMGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPPRIERAALD
GTEREVLFASGLSKPVALAVDSHLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPIG
LTVFEKWLYWIDRHQQMIEKIDMTRQEGRTKVQARIAQLSDIHAVKELNMQEYRQHPCSQ
DNGGCSHICIIKSDGTTRCSCPMHLVLLEDELSCGEPPTCSPQQFTCYTGEIDCIPVAWR
CDGFTECEDASDEKNCPLCSDAQFQCESGQCVEAGLQCNGEPNCQDNSDEKNCEVLCLTD
QFRCASGQCIGKSKKCDHSLDCSDSSDEQGCYTTEEPAPPATNTIGSIIGVILTVFVVGA
VYFVCQRVLCPRMKGDGETMTNDYVVHGPSSVPLGYVPHPGSLSGSLPEQSEYFSYRVSN
VFIPETRENVSRRAQERILSKTGDISSSDLNWWLLGHSVDSNVQHK
Download sequence
Identical sequences XP_015670105.1.16292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]