SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015719292.1.68032 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015719292.1.68032
Domain Number 1 Region: 32-292
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-56
Family YWTD domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 644-899
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 343-573
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-50
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 4 Region: 946-1205
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-39
Family YWTD domain 0.0000568
Further Details:      
 
Domain Number 5 Region: 1336-1371
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1298-1334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000229
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 1257-1297
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 9 Region: 902-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000399
Family EGF-type module 0.039
Further Details:      
 
Domain Number 10 Region: 297-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1215-1267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000239
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015719292.1.68032
Sequence length 1619
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X1 [Coturnix japonica]; AA=GCF_001577835.1; RF=representative genome; TAX=93934; STAX=93934; NAME=Coturnix japonica; AL=Chromosome; RT=Major
Sequence
MEAAPPLPLLLLLRLLAASVLRCEPGSAGASPFLLFANRRDVRLVDAGGTKLESTVVVSG
LEDAAAVDFQYSQGIVFWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGM
DSSTRKIIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEE
NNGGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPD
FTDIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGI
AVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLNPVMGYMYWTDWGES
PKIECAYLDGSERRVLVNTSLGWPNGLALDLEEDKLYWGDAKTDKIEVINVDGTMRKTLL
EDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKIRASRDIIIDQLPDLMGLKATSVTKVFG
TNPCAENNGGCSHLCFFTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLE
TNNNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWG
GKPRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREII
ADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQD
GLNDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSSPTSFLLFSQKSAISRMIP
DDQQSPDIILPMHGLRNVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSSPNQS
QNPEKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERG
YMYFTNMQERAPKIERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESC
DLSGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKTNGYKRTRIQGRIAHLT
GIHAVEELDMEEFSAHPCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTC
SPDQFTCATGEIDCIPMAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNG
EIDCQDKSDEVDCDTICLLNQFRCASGQCILLKQQCDSFPDCIDGSDELMCEKSKPSSDE
PQPHSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIA
PGSSQHGTFTGKDGISCGKSMMSSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQ
ILNPPPSPATDRSLYNAEMFYSSNIPSTTRSYRPYLIRGTAPPTTPCSTDVCDSDYTTSR
WKANKYYIDLNSDSDPYPPPPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_015719292.1.68032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]