SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015992628.1.101085 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015992628.1.101085
Domain Number 1 Region: 524-743
Classification Level Classification E-value
Superfamily Bet v1-like 3.37e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 122-243
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-26
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_015992628.1.101085
Sequence length 752
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X2 [Rousettus aegyptiacus]; AA=GCF_001466805.2; RF=representative genome; TAX=9407; STAX=9407; NAME=Rousettus aegyptiacus; AL=Scaffold; RT=Major
Sequence
MQQSSIPIPPPFSAPPTFLPCVTREGRRGLSSSGSAGRSAGVTATAAPDGWKGRLPSPLV
LLPRSARCQARRRRRRVGRTSSLLQHPSAPERALFPSPSPDISPRGLGASSGAARGAGAG
LLLVCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNAL
SYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRRQWIDAI
EQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILC
RQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPQVT
PKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKEIEKRRRIEEAYK
NAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTS
MPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDV
GGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWE
TTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPAS
VLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_015992628.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]