SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_015997222.1.101085 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_015997222.1.101085
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-94
Family Calponin-homology domain, CH-domain 0.00000329
Further Details:      
 
Domain Number 2 Region: 2174-2295
Classification Level Classification E-value
Superfamily PH domain-like 6.58e-34
Family Pleckstrin-homology domain (PH domain) 0.0000192
Further Details:      
 
Domain Number 3 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 4 Region: 600-741
Classification Level Classification E-value
Superfamily Spectrin repeat 6.24e-29
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 5 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-29
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.94e-27
Family Spectrin repeat 0.00000527
Further Details:      
 
Domain Number 7 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 8 Region: 1532-1672
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-24
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 9 Region: 815-948
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-24
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 10 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-23
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 2.08e-18
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 13 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-18
Family Spectrin repeat 0.00066
Further Details:      
 
Domain Number 14 Region: 1994-2069
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000236
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 15 Region: 1387-1476
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000262
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_015997222.1.101085
Sequence length 2332
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X1 [Rousettus aegyptiacus]; AA=GCF_001466805.2; RF=representative genome; TAX=9407; STAX=9407; NAME=Rousettus aegyptiacus; AL=Scaffold; RT=Major
Sequence
MTSATEYENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGQETRSAKDALL
SWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWNYLQELLRARRQRLEMTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITKATLQFTEEKEY
QPCDPQVIRDRVSHLEQCFVELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLNQIFQEAESMVAHKQFGHPQIEARIKE
VSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHKLLSGEDVGLDEGATRA
LGKKHKDFLEELEESRAAMEHLEQQAQAFPQEFRDSPDVTNRLQALRKLYQQVVAQADLR
RQRLQDALDLYTVFGETDACELWMGEKEKWLAQMEMPDTLEDLEVVQHRFDILDQEMKTL
MAQIDGVNLAANSLVESGHPRSGEVKQYQDHLNTRWQAFQTMVSEQRETVSSALRVHNYC
VDCEETSKWIMDKTKVVESTKELGQDLAGVIAIQRKLSGLERDVAAIQARVGALERESKR
LMESHPEQKEDIGRRQAYVEELWQGLQQALQDQEAFLGEASQLQAFLKDLDDFQSWLSMA
QKAVASEDMPESVTEAEQLLQQHAAIKDEIDGHQHNYEHVKASGEKVVHSQTDPEYLLLG
QRLEGLEPGWDALHRMWENRGRSLAQCLGFQEFQKDAKQAEAILSNQEYTLARLEPPDSL
EAAEAGIRKFEDFLVSMENNRDKVLSPVDSGNKLIAEGNLYSEKIKEKVQLIEDRHSKNN
EKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFMA
ELASHQGWLDSIDAEGKQLMEEKPQFEALVSQRLEALHRLWDELQATTQEIAQRLSAARS
SDLRSRTHADLKKWISAMEDQLRSDDLGKDLTSVNRMLAKLKRVEDQVTVRKEELGELFA
QMPSLGEEGEDVDLGIEKQFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSANYGTNLQTVQLLMKKNQTLQNEILGHTPRVEDVLKRGEQLVQEAEIDCQDIQERLG
HLRGSWDTLREAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQELYVISDEIPKDEEGAI
VMLKRHLRQQRAVEEYGRNIKQLAGRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLRDMAE
ERKRKLENMYHLFQLKRETDDLEQWITEKELVASSPEMGQDFDHVSLLRDKFRDFARETG
SIGQERVDSVNAIIERLIDAGHGEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTSTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELQQLGTQVQQFQDVAT
RLQTAYAGEKADAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWLE
NIIRQIETQERPRDVSSVELLMKYHQGIKAEIETRSKNFSACLELGKSLLQRQHQASEEI
REKLQQVVSRAKEMDEKWTARWDQLCILLEVCQFSRDASVAEAWLIAQEPYLASQDFGHT
VDSVEKLIKRHEAFEKSTASWAERFDALKRPTALELKEHQILEEPPAEETGPQEEEGETA
GEGPRGLYQAATERTSPQGEEERKWPRDLPPPPPPGPREQGQEKSGEDERPSTEPLFKVL
DTPLSEGDEPATLLAQRDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELT
FYKDAKNLALGTPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEM
LSWLQGVSTAINESQSIRIKAQSLPLPSITGPDASLSKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_015997222.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]