SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016079377.1.3490 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016079377.1.3490
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.39e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 2177-2294
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-33
Family Pleckstrin-homology domain (PH domain) 0.0000198
Further Details:      
 
Domain Number 4 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.65e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 5.88e-29
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-27
Family Spectrin repeat 0.00000475
Further Details:      
 
Domain Number 7 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-25
Family Spectrin repeat 0.00071
Further Details:      
 
Domain Number 9 Region: 1532-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-25
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 10 Region: 815-949
Classification Level Classification E-value
Superfamily Spectrin repeat 3.88e-24
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 529-636
Classification Level Classification E-value
Superfamily Spectrin repeat 7.52e-19
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 13 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 1.54e-18
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000187
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 15 Region: 1386-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000111
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016079377.1.3490
Sequence length 2331
Comment PREDICTED: spectrin beta chain, erythrocytic [Miniopterus natalensis]; AA=GCF_001595765.1; RF=representative genome; TAX=291302; STAX=291302; NAME=Miniopterus natalensis; AL=Scaffold; RT=Major
Sequence
MTSATEFENVANQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWKYLQDLLRARRQRLETTLALQKLFQDMLHS
IDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKMVEADIAIQGDKVKAITTATLQFTEGKGY
QPCDPQVIQDRVSHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAEGWIKEKEQIY
SSLDYGKDLTGVLILQRKHKAFEDELRGLDTHLDQIFQEAEGMVARKQFGHPQIEARIKD
VSAQWEQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHKLLSGEDVGQDEGATRA
MGKKHKDFLEELEESRVVMEHLEQQAQGFPQEFRDSPDVTNRLQVLRDLYQQVVAQADLR
RQKLQDALDLYTVFGETDACELWMGEKEKWLAQMEIPDILEDLEVVQHRFDILDQEMKTL
MTQIDGVNHAANSLVESGHPRSGEVKQYQDHLNTRWQAFQTMVSNWRDEVGSALRVHNFC
VDCEETSKWILDKTKVVESTKDLGRDLTGIIAIQRKLSGLERDVAAIQARVGALERESQR
LIASHPEQKEDLGQRQAYVEELWQGLQRALQGQEASLGEASQLQAFLQNLDDFQAWLSMA
QKTVASEDAPESLPEAEQLLQQHAAMKDEIDRHQDSYKRIQASGEKVLHGQTDPEYLLLG
QRLEGLGTGWDALCRMWENRGHFLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLETPDSL
EAAEAGIRKFEDFLVSMENNQDKVLSPVDSGNKLVAEGNLYSDKIKEKVHLIEDRHKKNN
EKAQEASVLLRDNLALQNFLQDCQELTLWINDKLLTSQDVSYDEARNLNNKWLKHQAFMA
ELASHQGQLESIDAEGKQLMEEKPQFADLVSQRLEALHRLWDELQATSKEKTQQLSAARS
SDLRSQTHADLNKWISAMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELAELFA
EMPSPGEEEGGADLSIERRFLDLLEPLGKRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSADYGINLQAVQLFMKKNQTLQNEILGHAPRVEDVLQRGQRLVEEAEIDCQDIEERLG
HLQSSWDTLREAAAGRLQRLRDASEAQQYYLDAGEAEAWISEQELYVISDETPKDEEGAI
VMLKRHLRQQRAVEEYGRNIKQLAGRAQGLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERKRKLENMYHLFQLKREADDLEQWIAEKELVVSSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNTIIERLIDAGHGEAATIAEWKDGLNEMWADLLELIDTHMQLLAASYDLH
RYFYTGTEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
SLQRAYAGEKADAIQDKEREVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGIRAEIETRSKNFNACLELGESLLQRRHQASEEI
GEKLQQVMSRRKEMNEKWEARWERLSMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTASWADRFAALEKPTTLELKERQIPEPPVEETGPQEEEGETAG
EGPRAPHRAATERTSPREEERQWPQDLQPPPPPGLHEKGLEEKPGGDERPATEPLFKVLD
TPLSEGDEPTTLPAQQDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSQLTF
YKDAKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEML
SWLQGVSTAINESQSIRIKAQSLPLPSITGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_016079377.1.3490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]