SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016082639.1.37387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016082639.1.37387
Domain Number 1 Region: 465-720
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 164-412
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-52
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 3 Region: 768-1028
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-40
Family YWTD domain 0.0000417
Further Details:      
 
Domain Number 4 Region: 1-113
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-23
Family YWTD domain 0.00014
Further Details:      
 
Domain Number 5 Region: 722-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000576
Family EGF-type module 0.017
Further Details:      
 
Domain Number 6 Region: 1158-1196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 1080-1118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 420-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000461
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 9 Region: 1120-1156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 116-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000327
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 11 Region: 1037-1090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000493
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016082639.1.37387
Sequence length 1446
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 [Ornithorhynchus anatinus]; AA=GCF_000002275.2; RF=representative genome; TAX=9258; STAX=9258; NAME=Ornithorhynchus anatinus; AL=Chromosome; RT=Major
Sequence
MDGSSRHVIINTDIYWPNGLTLDYKERKLYWADAKLNFIHKSNLDGTDRQAVVKGSLPHP
FALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQKRQPNATNPCG
TNNGGCSHLCLMAPSKPFYQCACATGVRLLEDGKTCKDGATELLLLARRTDLRRISLDTP
DFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDG
IAVDWVARNLYWTDTGTDRIEVTRLNGTLRKILISEDLEEPRAIVLDPTAGYMYWTDWGE
NPKIERAALDGSDRTVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNADGSGRRVL
VEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKQNAEREIIIDQLPDLMGLKATNVHRII
GSNPCAEENGGCSHLCLYRPQGLRCACPIGLELISDMKTCIVPEAFLLFSRRADIRRISL
ETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYP
EGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEW
GGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREV
IADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQ
AGWNECAASNGHCSHLCLAVPVGGFVCGCPAHYSLNPDNRTCRAPTTFLLFSQKNAINRM
VIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVVSSV
PNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPVGVVLKGEQDRPRAIVVNPE
KGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALALDSQLGKLFWADSDLRRIE
SSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARISQ
LSDIHAVKELNVQEYRHHPCSQDNGGCSHICIVKGDGTTRCSCPVQLVLLQDELSCGEPP
TCSPQQFTCFTGEIDCIPVAWRCDGFTECEDQSDELNCPVCSEAEFQCSSGQCIDGSLRC
NADANCQDKSDEKNCEVLCLMDQFRCANGQCIGKHKKCDHNMDCSDKSDELDCYPTEEPA
PQATNTVGSVIGVILTIFVFGAMYFICQRVLCPRMKGDGETMTNDYVVHGSASVPLGYVP
HPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNP
PPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRV
TAGAASKGYASDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPS
PCTDSS
Download sequence
Identical sequences XP_016082639.1.37387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]