SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016283272.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016283272.1.35504
Domain Number 1 Region: 290-549
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.93e-78
Family Eukaryotic proteases 0.000089
Further Details:      
 
Domain Number 2 Region: 171-282
Classification Level Classification E-value
Superfamily Kringle-like 2.32e-32
Family Kringle modules 0.00029
Further Details:      
 
Domain Number 3 Region: 71-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000373
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 110-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000016
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016283272.1.35504
Sequence length 559
Comment PREDICTED: hyaluronan-binding protein 2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MTTWTSGLSILLTILVGHGALGFSFLTSLLESIDRDWTPDDYEYSAEYYDHETSSNNVTE
YQDYAHWFSTEDPCQPNPCLHGGDCVIKGDNFTCDCPAPFTGVKCQTVLNPCQNNRCGKG
ECLIIRTPPYYKCACNHPYKGPNCSKVNSACRPNPCKNGGVCRRNRRRSKFTCSCPDGFK
GKFCEIGPDDCYEGNGLNYRGKVSKTISHLTCLHWNSYLLLDEAYNIFMEDAKKHDIGEH
NYCRNPDGDKSPWCFAKLDKKTVIWESCDVTPCSSSDVSESPWKPIELTVSSQMFSTCGM
PEINAKIKRIYGGLKSNPGKHPWQASLRMIPPETIPTPKGHLCGGVLIDPCWVVTAAHCV
MLKAKELRVVLGDQDLIKPEVSEQTFKVEKIFSHPDYYDDSEVPYNDIALLKLKPVNGHC
AQETKYVKTVCLSEEPFPTGTECYISGWGKTSTGKESQHLLDANVKLISKSHCNAPDQYD
NLVDDTMICAGIQGTDSCQGDSGGPLTCERDGKYYLYGVVSWGFQCGKKPGVYTLVPKFH
SWIKDTIREESESFRWFLN
Download sequence
Identical sequences F6XM86
ENSMODP00000012635 ENSMODP00000012635 XP_001377824.2.35504 XP_007479043.1.35504 XP_016283272.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]