SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016284776.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_016284776.1.35504
Domain Number - Region: 54-149
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000719
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016284776.1.35504
Sequence length 832
Comment PREDICTED: vacuolar protein sorting-associated protein 53 homolog [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MMEEEELEFVEELEAVLQLTPEVQLAIEQVFPSQDPLDRADFNAVEYINALFPTEQSLAN
IDEVVNKIRLKIRRLDDNIRTVVRGQTNVGQDGRHALEEAQKAIQQLFGKIKDIKDKAEK
SEQMVKEITRDIKQLDHAKRHLTTSITTLNHLHMLAGGVDSLEAMTRRRQYGEVANLLQG
VVNVLEHFHKYMGIPQIRQLSERVKAAQTELGQQILADFEEAFPSQGTKRPGGPSNVLRD
ACLVANVLEPRIKQEIVKKFIKQHLSEYLVLFQENQDVAWLDKIDRRYAWIKRQLVDYEE
KYGRMFPHEWYMTERIAVEFCHVTRVELAKIMRTRAKEIEVKLLLFAIQRTTNFEGLLAK
RFSGCTLSDGAPKKVEVPPPSTNPFLEDEPGPEMEELTMDKGDLDQPKKPKVPENPFHGI
ISKCFEPHLYVYIESQDKNLGELIERFVADFKAQGPPKPNTDEGGAVLPSCADLFVYYKK
CMVQCSQLSTGEPMIALTTIFQKYLREYAWKILSGNLPKTTSTSGGLTISSLLKEKEGSE
VAKFTLEELCLICSILSTAEYCLATTQQLEEKLKEKVDASLIERINLTGEMDTFSTVISN
SIQLLVQDLDAACDPALTAMSKMQWQNVEHVGDQSPYVTSVILHIKQNVPIIRDNLASTR
KYFTQFCIKFANSFIPKFINHLFKCKPISMVGAEQLLLDTHSLKMVLLDLPSIGSQVVRK
APASYTKIVVKGMTRAEMILKVVMAPHEPLVVFVDNLIKLLTDCNTETFQKILDMKGLKR
SEQSSMLELFRQRLPTPPSASEGTGSTSLTAPTPEQESSRIRKLEKLIKKRL
Download sequence
Identical sequences F6WN34
ENSMODP00000012683 ENSMODP00000012683 XP_001364702.2.35504 XP_016284776.1.35504 13616.ENSMODP00000012683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]