SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016349086.1.79318 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016349086.1.79318
Domain Number 1 Region: 4-127
Classification Level Classification E-value
Superfamily Histone-fold 7.79e-49
Family Nucleosome core histones 0.00000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016349086.1.79318
Sequence length 128
Comment PREDICTED: histone H2A-like [Sinocyclocheilus anshuiensis]; AA=GCF_001515605.1; RF=representative genome; TAX=1608454; STAX=1608454; NAME=Sinocyclocheilus anshuiensis; AL=Scaffold; RT=Major
Sequence
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKPAKSK
Download sequence
Identical sequences A0A0F8C6U1 A0A0P7UZR1 A0A1D8QQG5 A0A2D0SRM3 B5X851 C1BEH9 C1BX71 Q5XJK2
7955.ENSDARP00000090794 ENSDARP00000090794 NP_001005967.1.45394 NP_001297973.1.71217 XP_005813815.1.87360 XP_007243489.1.101067 XP_008278249.1.38333 XP_008330834.1.100486 XP_010749214.1.61708 XP_012683108.1.3086 XP_013992645.1.97760 XP_016118666.1.42290 XP_016132196.1.42290 XP_016345846.1.79318 XP_016349085.1.79318 XP_016349086.1.79318 XP_016416878.1.44103 XP_017345146.1.5077 XP_018546810.1.34915 XP_018610648.1.37976 XP_019941073.1.63745 XP_020341321.1.87700 XP_020476279.1.23826 XP_020790210.1.12261 XP_021479503.1.32639 XP_022054082.1.10920 ENSDARP00000090794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]