SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016555428.1.72714 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016555428.1.72714
Domain Number 1 Region: 393-611
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000785
Family Tropomyosin 0.00055
Further Details:      
 
Domain Number 2 Region: 998-1231
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000392
Family Tropomyosin 0.0026
Further Details:      
 
Domain Number 3 Region: 882-1078
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016555428.1.72714
Sequence length 1487
Comment PREDICTED: early endosome antigen 1 [Capsicum annuum]; AA=GCF_000710875.1; RF=representative genome; TAX=4072; STAX=4072; NAME=Capsicum annuum; cultivar=Zunla-1; AL=Chromosome; RT=Major
Sequence
MEADTATTDVPVVQVSEKIEGKDDLIKVSNGEKEHEESAFDGEFIKVEKEALESKDGSHA
AAEASPAQGKVYAVNRSSNISSASREYLEAQEKANELELELERVAGALKDTESQNVKLKD
ELSLTTEKLEETAKKFEELELDHKKLQEQIAEAETRSNTELNALQEALQAHELNNKEHVN
VKEAFDRLGLEFESSQKKMEELEQALLASAGEAQKFEELHKQSGSLAESETKRALDFERL
LELSKQSAKEVEDQMASLQEELKGLNEKIAENQKVEEALTTTASELCKVQGELEISKSQV
QDIENKLASKEALIDELSQEIDVRKASESQVKEDISSLELLLSSTKEDLRAKASELEDIE
LKLQEEVGLKKHIEAKLKSQETQLSVSQEELAKLSIEKGALEASVAELNNDVVQMKELCS
NLEVQLQLSDEKFCNADSLLSQALANSAELEQKLKSLEELHHESAHAITTANQKIFELED
MLHISNAAIEEAKSQLKEMENRCVAAEERNVELEQQLNQAELKNNDMKKELEEFSGKVFE
LNTTLEKTLEEREQLDARLQEYGKNIAHLDSELVESTARNSELEAELKNIADKCAEHEGR
ANTTDQRSRELEDLMLVSHSKVEESSKKVSNLELLLETEKYKTQELEEQISTLEKKGVAV
EAESKKHSDRASELEAEVEAFQTKLSSLEAAVAETKEKERELSQFLKSVTEEKINLEDVY
KRELQEFSGKVSELNATLEKTMEEKEQLDTRLQEYEEKIAHLDSEFVKSSAHNLELEAEL
RSAADKWAEHEGRANTTDQRSRELEDLMLVSHSKVEEAGKKVRNLELLLETEKYRIQELE
EQICTLDKKCVAAEAESKKHSDRASELETEVEAFQTKSSSLEVALVETTEKEKDLSRCLN
SLTEEKKNLEDVYRISIEKLAETENLLEVLRSELNATQQRLESIENDLNATVLRESEVME
KLKSAEKQLEQQGRVLEKATARSIELESLHDTLKMDAELKLQEATGKFVTRDSEAQTLNV
KLKALEDQLKSYEEQIGKSAESFSAVKEELDQVLVKLASSETDNEDLKNKILEVEEKAAD
ILSENQQLMETNVLLKSRVSDLEELLNSAHAEKEDSIQQLVSHMNTITELKDQHSKASEL
QSATEARISETEAKLHEAIQKFTQKESEGKELMDKLYSLETLVKTYEEQVRETANPAEAR
KVELEQSRKNLSDLETIVEELKGKCTELEKEKEGLTMENSELKGEVASNGSILNDLEAKV
SAAFAEKNESVEELKSSNQVIDDLKEQLSSEGKKLQLQLSSILEEKNLLNETHQTSKKEL
QNVIAHLEEQLEEIKSSEDSLKSRIKELEDHLGSAEAQGKEEKEAMSSKGSEELQVKSKE
VVVLQNQVKELEEKLQQADAILKQKDIGGSSSDRKDDLEVKSRDIGEMLSIPTKRKSKKK
LEVSSTRPSSSVSQVQHIEGSSAIPLKFILGVALVSVILGIILGKRY
Download sequence
Identical sequences A0A1U8F7Y0
XP_016555428.1.72714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]