SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016599197.1.99153 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016599197.1.99153
Domain Number 1 Region: 337-537
Classification Level Classification E-value
Superfamily MIR domain 1.05e-59
Family MIR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016599197.1.99153
Sequence length 935
Comment Glycosyl transferase, family 39 [Penicillium expansum]; AA=GCF_000769745.1; RF=representative genome; TAX=27334; STAX=27334; NAME=Penicillium expansum; strain=MD-8; AL=Contig; RT=Major
Sequence
MAQKAKDTLAVRPQSRGRRSPSRSPKPKNRKPLPVPQTYASDGVKNNDIFKLPGSDYRLI
VLVTLIAAAVRLFRIYQPTSVVFDEVHFGGFASKYIKGKFFMDVHPPLAKLLLTLAGWLA
GFDGSFDFKDIGKDYLEPGVPYVAMRMLPAILGVLTVPLMFLTLKVTGCRSSTSLLGAGL
VIFDNALVTQSRLILLDSPLIFFTALTALAFSCFTNQQELGPAHAFRGPWWFWLVCTGLS
LGATLSVKWVGLFTMAWVGSLTALQLWVLLGDAKNVTPRLWLKHLFSRIFCLIFIPLGFY
LAMFAIHFACLVNPGEGDGFMSSEFQATLNSKSMQDVPADVSFGSRVSLRHLNTQGGYLH
SHPHMYPTGSKQQQITLYPHKDENNEFLLENSTQPLGPYGEVEGAFAWDNLTAPGFIEDG
STIRLYHVITHRRIHSHDERPPVTEADWQYEVSAYGYEGFAGDANDLWRVEIVKSMSETP
ESKKRLRTIQSKFRLVHVMTGCVLFSHKVKLPEWGWEQQEVTCAKGGTLPNSVWYIESNQ
HPAMAPDAERVNYRNPGFLGKFWELQKVMWTTNAGLVESHAWDSRPPSWPTLLRGINFWG
KDNRQIYLLGNPLIWWSTTLAIGIYFVFKALSIVRWQRSCGDYKHVSFKRFDYEVGTSVL
GWFFHYFPFYLMARQLFLHHYLPALYFAIMVLCQEFDFLTNRIKSLGLASKPLIGKALIA
IFLGLSVVVFTLYAPLVYGNPWTRDACNQVKLLGSWDFDCNTFHTDLSQYITQYVPTLPP
VAAPTTAAQAPPPPPPVQAQEPVPASEAIQESEPAAVTSPKIKGSMARVEYRDQNGQVLD
ESLVASLRAEGKVKFETRYEPGKPLEHAHDVPVVDGQLAPPHPDVQGQNPETGSAPEDSV
PPESPASVAEGNERSVEQSSSMEAKPASESNEATK
Download sequence
Identical sequences A0A0A2KCD7
XP_016599197.1.99153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]