SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016612180.1.7107 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016612180.1.7107
Domain Number 1 Region: 3-265
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-88
Family Capz beta-1 subunit 0.0000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016612180.1.7107
Sequence length 268
Comment hypothetical protein SPPG_01576 [Spizellomyces punctatus DAOM BR117]; AA=GCF_000182565.1; RF=representative genome; TAX=645134; STAX=109760; NAME=Spizellomyces punctatus DAOM BR117; strain=DAOM BR117; AL=Scaffold; RT=Major
Sequence
MVDPVDCALDLMRRLPPQKVEESLANLVELAPHLTEELLSAIDQPLKLQRCKQTGKDYLL
CDYNRDGDSYRSPWSNEYEPPLSDGAQPSPKLRKLEIAANDAFTTYRELYFDGGVSSVYM
WDLDEGFASVVLIKNVNESDSGLKGSWDSIHVIEVQESGRSAHYKLTSTVMLYMETGGVK
FGNVNLSGSLTRQAEQDYPLDDYGTHVANMGRLVEDMEIKLRNNLQVIYFGKTKDITNDL
RSINSLTDARKQMAIQSELIGKLQARSH
Download sequence
Identical sequences A0A0L0HS06
XP_016612180.1.7107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]