SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016617399.1.57598 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016617399.1.57598
Domain Number 1 Region: 324-549
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000373
Family Tropomyosin 0.0041
Further Details:      
 
Domain Number 2 Region: 821-1001
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000268
Family Tropomyosin 0.0043
Further Details:      
 
Domain Number 3 Region: 975-1167
Classification Level Classification E-value
Superfamily Tropomyosin 0.000051
Family Tropomyosin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016617399.1.57598
Sequence length 1275
Comment hypothetical protein Z519_08513 [Cladophialophora bantiana CBS 173.52]; AA=GCF_000835475.1; RF=representative genome; TAX=1442370; STAX=89940; NAME=Cladophialophora bantiana CBS 173.52; strain=CBS 173.52; AL=Scaffold; RT=Major
Sequence
MFQRLKGVIDSHIAEEQARQRQAANSAQAARTPQKRRPQAQNGSRQRAGSRLREQQTNVS
TEKGPDPSEFEPEFAIGGDESAVPSRAGTPRPEGTGKEKEQVKEEDAPVSEDGGDTHTLA
ESADSKVSTVSDVNGNTTTSLRPQDLPTEVRVKLRRLDRMESKYAELLKVYRTAHARIQA
VESFEASLRENTPLTSINDPSALVEYLNQINLKSDMVVDELKRVTSDRDDYKKKFQAAEE
ETAGLREEVASLKSKLETASQQKASGPEKNFSIGSPHITVAGDNSSLKEAADSEQTAKSP
TTTASRIASFSLFSPRHKAMSPPKETSEEFFSFESEQSKMEAELHEKQAEVEDLKKQLAS
LKADLKVARESTESMVESLETATRELHNLREAKDKFDEIKNELQNRIAELETRAASNITR
TDEHQKEIDELQARKLEAVSQLQLLESQIKELEATNAKLEEQIVSKGKDAELLNEKLSQK
DSIVKDLEDSLALYKSAERQEASRRQNEQSSEKKLATMQGIMDTLRGQLDKAESTVGELK
AEIQSTREEHSRHPSTKVFGFLDDETKSKFDTLTTREDVVQYLSEIFGLQKAPPNKAVAE
TATASPAPSEAGTGVSKKKNKKKKKGKGQSQTAADDAAETVTPVKVSENLAEVDDVEAGA
DENISKLQQEISDLKAELASKEDAIHRLSKQLKDQEELQEEIETLRDDLLHQGEEHVEAR
DALKDAQTQKNNLQDAVDKLEKELLEARVAIASGTEREKTHKEILQQFDELKDRCSGLER
DLAASEQLAAGRFKDITDLKELLAKSQPELRNLRSEIAELKTAKDDLKNKTGEFNRLEAR
HEDIKAELKGLSRRLGDKDSEIKELQQKIEQEISARTRIEKDLDKAQSDLQTVESRHDQA
TTRSEQLAKDLLKAKEESTTLTTKLRDLEEQVSAQARQITELKEEISLKTALHASSQALV
QSLRDQTHELNMQAREAGTRAESLEEELGETQRMLSERTREGQTMRMLLDQSSAGTEARI
REMKERMDAAIEERDRVEDEASVSQRRMMREVEEARSKARDAQRSLKILEDEKEELESRL
KEWKRRREELEQSATKAAREVEEVKAAMTVLREALDDSERQMRELDAQKADLRRVGDEAK
ERVEKLTKANKNLTEELKAAQANSRLLSRPNLGRVDSNAPSSRTSIDSGHARSPAPKERV
LSTTTSRSETPVAPAGAPAGLSQGTVDYVYLKNVLLQFLEQRDKGHQRQLIPVLGMLLHF
DRKDEQKWIAAISTR
Download sequence
Identical sequences A0A0D2HIZ8
XP_016617399.1.57598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]