SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016633526.1.52555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016633526.1.52555
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-79
Family Capz beta-1 subunit 0.0000000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016633526.1.52555
Sequence length 273
Comment hypothetical protein Z520_04979 [Fonsecaea multimorphosa CBS 102226]; AA=GCF_000836435.1; RF=representative genome; TAX=1442371; STAX=979981; NAME=Fonsecaea multimorphosa CBS 102226; strain=CBS 102226; AL=Scaffold; RT=Major
Sequence
MASEAQFDAALDLLRRLSPLKVSDNLTSITTLVPDLTEDLLSSVDQPLTSARCKKTGRDY
LLCDYNRDGDSYRSPWSNEFEPPLDDATYPSDRVRKMEVEANTAFDVYRQMYYEGGTGSV
YLWDLDDGFAGVVLLKKAVGQEAGWDSIHVFEVDERRGSGRTCHYKLTSTVILHLGRDSE
GLGSLNLAGSMTRQVEADLAVENVGGQGKDGGHVCNAGRLIEDMEGKMRNMLQEVYFGKA
KDVVGDLRSVAPLTGVNRERQAQRDVISSMGGK
Download sequence
Identical sequences A0A0D2KRX6 A0A178CAJ2
XP_016633526.1.52555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]