SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016637995.1.52555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016637995.1.52555
Domain Number 1 Region: 321-546
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000163
Family Tropomyosin 0.0028
Further Details:      
 
Domain Number 2 Region: 962-1164
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000015
Family Tropomyosin 0.002
Further Details:      
 
Domain Number 3 Region: 820-1003
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000458
Family Tropomyosin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016637995.1.52555
Sequence length 1289
Comment hypothetical protein Z520_00564 [Fonsecaea multimorphosa CBS 102226]; AA=GCF_000836435.1; RF=representative genome; TAX=1442371; STAX=979981; NAME=Fonsecaea multimorphosa CBS 102226; strain=CBS 102226; AL=Scaffold; RT=Major
Sequence
MFQRLKGVIDSHIAEEQARQRQAANSAQAARPPQKRRPQAQNGSRQRAGSRLREQQSNAS
TDEGPDPSEFEPEFAIGDDDSAVPSRAATPKPEGTGKEKEQAKEKGTSASEDGLDTQSLA
ESADGRVSDVNGTATAPLRPQDLPTEVRVKLRRLDRMESKYAELLKAYRTAHARIQTVES
FEASLRENTPLTSINDPGALVEYLNQMNLKSDMVVDELKRVTSDRDDYKKKFQAAEEESK
GLREEMTSMKSKLETLSQQKASEGEKNFSIGSPHITADGDNASLKEAAESEQTAKSPAST
ASRIASFSLFSPRQKAMSPPKETSEEFFSFESEQSKMETELHESQAEVEDLKKQLSSLQG
DLKVARESTEGMVESLETATRELHNLREAKDKFDETKNELQNRVSELEARAASNTTRTDE
LQKEIDELQARKLEAVAQVQSLESQIKELEATNTELEGRIVSRTKDAELLNEKLSQKDSI
VKDLEDTLAMYKSAERQEAARSPDEGSSAKKLATMQGIMDSLRNQLDKAETTVAELKAEI
QSTREEYLHRPSTKVFGFLDEGIKTRLDTLQTREDVVQYLSENFGLQRASSTKAVTETAT
ASPAPSEAGTSASKKKNKKKKKGKGQPQAATDDASETVTPVKVSENLAEVDDIDASVDDK
LPAADVSKLEQEISELKAELTSKEDAIKRLSKQLKDQEELQEEIETLRDDLLHQGEEHVE
ARDALKDAQVQKNNLQDAVDKLEKELLEARAAIAGGADREKAHKEIVQQYDELKVRCSKL
ENDLSASEQLAAGRFKDITDLKELLAKSQPELRNLRNEVAELKTAKEDLKNKTGEFNRLE
ARHEDIKAELKGLSKRLGDKDNEIKELQQKIEQEISARTRMEKDLDRANSDLQMAESRYE
KATARSDQLSKDLEKAKEESTTLKTKLSDLEEQVSVQARQISELKDEISLKTALHTSAQA
LVQSLRDQTHELNMQSREATTRAENLEEELNETQRMLSERTREGQTMRMLLDQSSAGTES
RIREMKERMDAAIEERDRVEDEASVSQRRMMREVEEARSKARDAQRSLKVLEDEKEELES
RLKEWKRRREELEQSATRAAREVEEVKAAMTGLREALDDSERQVRDLDAQKAELRRIGDD
AKERVEKLTKANKNLTEELKAAQANSRIPGRPPNLGRVDSNAPSSRTSIDSANNARSPAP
KERAERGVLSTTTSRSETPNTMAAGAGAGAPAAGLSQGTVDYVYLKNVLLQFLEQKDKGH
QRQLIPVLGMLLHFDRKDEQKWIAAISTR
Download sequence
Identical sequences A0A0D2KCK5 A0A178CT88
XP_016637995.1.52555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]