SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016682122.1.88148 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016682122.1.88148
Domain Number 1 Region: 90-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.92e-17
Family Skp1 dimerisation domain-like 0.00057
Further Details:      
 
Domain Number 2 Region: 16-80
Classification Level Classification E-value
Superfamily POZ domain 0.000000002
Family BTB/POZ domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016682122.1.88148
Sequence length 348
Comment PREDICTED: SKP1-like protein 21 isoform X1 [Gossypium hirsutum]; AA=GCF_000987745.1; RF=representative genome; TAX=3635; STAX=3635; NAME=Gossypium hirsutum; cultivar=TM-1; AL=Chromosome; RT=Major
Sequence
MSEVDMAVIKPEIMKSYIWLQTVDGSIQQVEQEIAMFCPMICHEVIQKGMGSSKNYAISL
PQQVNPAMLSLILDYCRFHQVPGRSNKERKSFDEKFIRMDTKRLCELTSAADSLQLKPLV
DLTSRALARIIEGKAPEEIREIFHLPDDLTEEEKLEPLKNATDDPRIRLLNRLYAKKRKE
LKEREKLKNVEVDEELVDDRSVDDLLSFINGDDGDSKGIKTSKSKKKNRRRKDLLKSTSA
HEATKNHNKESNGLNSVCRSAEVGQILPGVGATTNLQDVEDDIFPNKNEFDDGDIDDEID
PTLKEKIDREVEDFARRLNSDWPERMQEILSLGQEKKPVHLSLNGKGS
Download sequence
Identical sequences A0A0D2R5M3 A0A1U8IVG9
Gorai.004G158900.2|PACid:26775342 Gorai.004G158900.3|PACid:26775345 Gorai.004G158900.5|PACid:26775346 Gorai.004G158900.6|PACid:26775343 Gorai.004G158900.7|PACid:26775344 XP_012475217.1.20347 XP_012475218.1.20347 XP_012475219.1.20347 XP_012475220.1.20347 XP_016682122.1.88148 XP_016682123.1.88148 XP_016682124.1.88148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]