SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016735696.1.88148 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016735696.1.88148
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.6e-35
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 100-153
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 5.13e-21
Family Ribosomal protein S27a 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016735696.1.88148
Sequence length 156
Comment PREDICTED: ubiquitin-40S ribosomal protein S27a [Gossypium hirsutum]; AA=GCF_000987745.1; RF=representative genome; TAX=3635; STAX=3635; NAME=Gossypium hirsutum; cultivar=TM-1; AL=Chromosome; RT=Major
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKKVKLAVLQFYKVDESGKVQRLRKE
CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAGGD
Download sequence
Identical sequences A0A0D2UMI5 Q2QDG1
XP_012437931.1.20347 XP_012454187.1.20347 XP_012473448.1.20347 XP_012480015.1.20347 XP_012490278.1.20347 XP_016695885.1.88148 XP_016701238.1.88148 XP_016701947.1.88148 XP_016710599.1.88148 XP_016735696.1.88148 XP_016739609.1.88148 XP_017626540.1.75545 XP_017627244.1.75545 XP_017637858.1.75545 XP_017649435.1.75545 XP_017976796.1.67643 XP_021280301.1.83089 Tc01_g032560 Gorai.007G119500.1|PACid:26783194 Gorai.011G049100.1|PACid:26809088 CGD0002820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]