SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016788858.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016788858.1.37143
Domain Number 1 Region: 13-126
Classification Level Classification E-value
Superfamily POZ domain 2.43e-26
Family BTB/POZ domain 0.00062
Further Details:      
 
Domain Number 2 Region: 314-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 355-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.68e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 278-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000167
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016788858.1.37143
Sequence length 449
Comment PREDICTED: zinc finger and BTB domain-containing protein 14 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTY
FKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFL
DKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEG
TPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALT
FNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHT
ADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERP
FACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP
SAIQSETEQLQAAAMAAEAEQQLETIACS
Download sequence
Identical sequences A0A096NUA3 A0A0D9RYC5 A0A2K5EQL8 A0A2K5HU77 A0A2K5MXB3 A0A2K5S5G6 A0A2K5UZ41 A0A2K5YRV4 A0A2K6DH08 A0A2K6LV68 A0A2K6NY38 A0A2K6UX81 F6RIC1 F7HM25 G3RT13 H2NVX4 K7DTG3 M3Y0U9 O43829
ENSPVAP00000011960 ENSPVAP00000011960 ENSPPYP00000010129 ENSGGOP00000018938 ENSP00000349503 ENSMMUP00000028983 ENSMPUP00000004950 ENSGGOP00000018737 NP_001137295.1.87134 NP_001137295.1.92137 NP_001230631.1.87134 NP_001230631.1.92137 NP_001230633.1.87134 NP_001230633.1.92137 NP_001252799.1.72884 NP_003400.2.87134 NP_003400.2.92137 XP_002924902.1.58354 XP_003778992.1.23681 XP_003792060.1.62490 XP_004059204.1.27298 XP_004059205.1.27298 XP_004411829.1.74151 XP_004421061.1.5094 XP_004683809.1.23501 XP_005587170.1.63531 XP_005587171.1.63531 XP_005587172.1.63531 XP_005587173.1.63531 XP_006920130.1.64745 XP_007972747.1.81039 XP_007972748.1.81039 XP_007972749.1.81039 XP_007972750.1.81039 XP_007972751.1.81039 XP_008688473.1.72690 XP_008688477.1.72690 XP_008969423.1.60992 XP_008969424.1.60992 XP_008977795.1.60252 XP_009250533.1.23681 XP_010333844.1.74449 XP_010371686.1.97406 XP_011364475.1.92234 XP_011364477.1.92234 XP_011734803.1.29376 XP_011734804.1.29376 XP_011734805.1.29376 XP_011734806.1.29376 XP_011734807.1.29376 XP_011734808.1.29376 XP_011734809.1.29376 XP_011734810.1.29376 XP_011734811.1.29376 XP_011734812.1.29376 XP_011734813.1.29376 XP_011813193.1.43180 XP_011813195.1.43180 XP_011813196.1.43180 XP_011851704.1.47321 XP_011911632.1.92194 XP_011911633.1.92194 XP_011911634.1.92194 XP_011911635.1.92194 XP_011911636.1.92194 XP_011911638.1.92194 XP_011911639.1.92194 XP_011911640.1.92194 XP_012302315.1.9421 XP_012302316.1.9421 XP_012906872.1.14098 XP_012906873.1.14098 XP_014635756.1.5094 XP_014977073.1.72884 XP_014977074.1.72884 XP_014977075.1.72884 XP_014977077.1.72884 XP_015295621.1.63531 XP_016788857.1.37143 XP_016788858.1.37143 XP_016788859.1.37143 XP_016788860.1.37143 XP_016788861.1.37143 XP_016788862.1.37143 XP_017399359.1.71028 XP_017399360.1.71028 XP_017399361.1.71028 XP_017723410.1.44346 XP_017723411.1.44346 XP_017723412.1.44346 XP_017723414.1.44346 XP_017723415.1.44346 XP_017723416.1.44346 XP_017819390.1.60252 XP_019611332.1.88060 XP_019611333.1.88060 XP_019661094.1.58354 XP_021541883.1.83697 XP_021541884.1.83697 gi|19923242|ref|NP_003400.2| gi|219689126|ref|NP_001137295.1| ENSMMUP00000028983 ENSMPUP00000004950 ENSPPYP00000010129 9544.ENSMMUP00000028983 9606.ENSP00000349503 ENSPANP00000016627 ENSCJAP00000029042 ENSP00000349503 ENSP00000383009 ENSP00000349503 ENSP00000383009 ENSP00000478971 ENSP00000484129 ENSCJAP00000029042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]