SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016810989.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016810989.1.37143
Domain Number 1 Region: 183-304
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000000047
Family SH2 domain 0.0024
Further Details:      
 
Domain Number 2 Region: 3-62
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000615
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016810989.1.37143
Sequence length 339
Comment PREDICTED: SH2 domain-containing protein 5 isoform X3 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MAHALRRILYSTWCPADCQFAFMARNPRSPASKLFCHLFVGSQPGEVQILHLLLCRSFQL
AYLLQHPEERAQPEPCPGPTGEVPLKPLSSSGGLVREPFGRDQLSQNVHALVSFRRLPAE
GLVGSGKELPESEGRARHARLGNPYCSPTLVRKKAIRSKVIRSGAYRGCTYETQLQLSAR
EAFPAAWEAWPRGPGGHSCLVESEGSLTENIWAFAGISRPCALALLRRDVLGAFLLWPEL
GASGQWCLSVRTQCGVVPHQVFRNHLGRYCLEHLPAEFPSLEALVENHAVTERSLFCPLD
MGRLNPTYEEQDCGPPGRPPRTLRPLSHAKSEAELQGLG
Download sequence
Identical sequences A0A2I3SIZ0
NP_001096630.1.87134 NP_001096630.1.92137 XP_008965310.1.60992 XP_016810989.1.37143 gi|157041224|ref|NP_001096630.1| ENSP00000364171 ENSP00000364171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]