SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_016824932.1.28591 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016824932.1.28591
Domain Number 1 Region: 12-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.29e-41
Family G proteins 0.0000252
Further Details:      
 
Domain Number 2 Region: 190-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000654
Family SOCS box-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_016824932.1.28591
Sequence length 279
Comment PREDICTED: ras-related protein Rab-40B isoform X2 [Cricetulus griseus]; AA=GCF_000419365.1; RF=na; TAX=10029; STAX=10029; NAME=Cricetulus griseus; AL=Scaffold; RT=Major
Sequence
MMSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQAAGERGGRSHLGGIDHKTTTILLD
GRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGINRWIKEIDEHAPGV
PKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHG
MDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPVTLRSHLKSFSMANGLNTRMMHGR
SYSLTASSSHKRSSFCKARNSRSPQSPPRNCTRNSCKIS
Download sequence
Identical sequences XP_016824932.1.28591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]