SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016863747.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016863747.1.92137
Domain Number 1 Region: 197-317
Classification Level Classification E-value
Superfamily EF-hand 9.22e-37
Family Osteonectin 0.01
Further Details:      
 
Domain Number 2 Region: 286-379
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.37e-29
Family Thyroglobulin type-1 domain 0.00078
Further Details:      
 
Domain Number 3 Region: 126-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000457
Family Ovomucoid domain III-like 0.0079
Further Details:      
 
Weak hits

Sequence:  XP_016863747.1.92137
Domain Number - Region: 392-430
Classification Level Classification E-value
Superfamily ARM repeat 0.0317
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016863747.1.92137
Sequence length 433
Comment PREDICTED: testican-3 isoform X3 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNK
FRDDDYFRTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHRMKE
AGVDHRQWRGPILSTCKQCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHC
PCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKTLLRPERSRFDT
SILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDKNEQCTKAFFNSCDTYKDSLISNN
EWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPTQCHGSVGQCWCVD
RYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDEDEG
DDDDGGDDHDVYI
Download sequence
Identical sequences ENSP00000350153 ENSP00000425502 ENSP00000425570 gi|93141003|ref|NP_001035249.1| NP_001035249.1.87134 NP_001035249.1.92137 XP_016863747.1.92137 ENSP00000350153 ENSP00000425502 ENSP00000425570 9606.ENSP00000350153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]