SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016866100.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016866100.1.92137
Domain Number 1 Region: 9-140,171-277
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.34e-73
Family Calponin-homology domain, CH-domain 0.0000355
Further Details:      
 
Domain Number 2 Region: 8058-8213
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 8460-8574
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 7838-7962
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-18
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 1624-1759
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-17
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 6977-7118
Classification Level Classification E-value
Superfamily Spectrin repeat 5.47e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 7 Region: 3334-3456
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-16
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 8 Region: 4508-4665
Classification Level Classification E-value
Superfamily Spectrin repeat 1.36e-16
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 9 Region: 7430-7561
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 10 Region: 7091-7235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000017
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 11 Region: 2460-2590
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000755
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 12 Region: 4290-4446
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000106
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 13 Region: 3762-3883
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000113
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 14 Region: 5048-5206
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000131
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 15 Region: 3118-3242
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000298
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 16 Region: 7966-8076
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000662
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 17 Region: 6789-6907
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000851
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 3890-4004
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000103
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 19 Region: 558-700
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000322
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 20 Region: 2678-2804
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000519
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 21 Region: 7357-7464
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000119
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 22 Region: 3568-3700
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000183
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 23 Region: 7628-7778
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000185
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 24 Region: 1406-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000644
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 25 Region: 2832-2949
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000229
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 26 Region: 5732-5809,5920-5966
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 27 Region: 2248-2403
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000276
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 28 Region: 5929-6072
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000446
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 4959-5082
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000497
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 30 Region: 1089-1227
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000115
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 31 Region: 5474-5593
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000152
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 32 Region: 8537-8697
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000173
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 33 Region: 1924-2075
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000018
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 34 Region: 1545-1655
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000222
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 35 Region: 5176-5280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000224
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 36 Region: 1714-1865
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000295
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 37 Region: 3461-3566
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000089
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 38 Region: 5598-5688
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 39 Region: 3033-3131
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000056
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 40 Region: 6082-6194
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000017
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 41 Region: 4207-4335
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000216
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 42 Region: 6560-6644
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000246
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 43 Region: 2051-2154
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000458
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 44 Region: 3245-3346
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000547
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 45 Region: 4002-4134
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000838
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 46 Region: 4877-4988
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000968
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 47 Region: 6384-6489
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000013
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 48 Region: 888-1014
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000136
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 49 Region: 2153-2277
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000432
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_016866100.1.92137
Sequence length 8837
Comment PREDICTED: nesprin-1 isoform X9 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MIKTIYKTPGMIKDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEV
LSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTDIADGRPSIV
LGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKK
ALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDA
FTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDEILPGF
PSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKR
KQIEHLIQPLHRDGKLSLDQALVKQSWDRVTSRLFDWHIQLDKSLPAPLGTIGAWLYRAE
VALREEITVQQVHEETANTIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQL
EDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLLQN
YVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRNLSVEVR
SVRSMLEEVISNWDRYGNTVASLQAWLEDAEKMLNQSENAKKDFFRNLPHWIQQHTAMND
AGNFLIETCDEMVSRDLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEYTDCVVTLSA
FATEAHKKLSEPLEVSFMNVKLLIQDLEDIEQRVPVMDAQYKIITKTAHLITKESPQEEG
KEMFATMSKLKEQLTKVKECYSPLLYESQQLLIPLEELEKQMTSFYDSLGKINEIITVLE
REAQSSALFKQKHQELLACQENCKKTLTLIEKGSQSVQKFVTLSNVLKHFDQTRLQRQIA
DIHVAFQSMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEKGDPEELLRR
HTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLLHL
KIDVEKNRFLASVEECRTELDRETKLMPQEGSEKIIKEHRVFFSDKGPHHLCEKRLQLIE
ELCVKLPVRDPVRDTPGTCHVTLKELRAAIDSTYRKLMEDPDKWKDYTSRFSEFSSWIST
NETQLKGIKGEAIDTANHGEVKRAVEEIRNGVTKRGETLSWLKSRLKVLTEVSSENEAQK
QGDELAKLSSSFKALVTLLSEVEKMLSNFGDCVQYKEIVKNSLEELISGSKEVQEQAEKI
LDTENLFEAQQLLLHHQQKTKRISAKKRDVQQQIAQAQQGEGGLPDRGHEELRKLESTLD
GLERSRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELEQT
KEFSKRTESIAVQAENLVKEASEIPLGPQNKQLLQQQAKSIKEQVKKLEDTLEEDIKTME
MVKTKWDHFGSNFETLSVWITEKEKELNALETSSSAMDMQISQIKVTIQEIESKLSSIVG
LEEEAQSFAQFVTTGESARIKAKLTQIRRYGEELREHAQCLEGTILGHLSQQQKFEENLR
KIQQSVSEFEDKLAVPIKICSSATETYKVLQEHMDLCQALESLSSAITAFSASARKVVNR
DSCVQEAAALQQQYEDILRRAKERQTALENLLAHWQRLEKELSSFLTWLERGEAKASSPE
MDISADRVKVEGELQLIQALQNEVVSQASFYSKLLQLKESLFSVASKDDVKMMKLHLEQL
DERWRDLPQIINKRINFLQSVVAEHQQFDELLLSFSVWIKLFLSELQTTSEISIMDHQVA
LTRHKDHAAEVESKKGELQSLQGHLAKLGSLGRAEDLHLLQGKAEDCFQLFEEASQVVER
RQLALSHLAEFLQSHASLSGILRQLRQTVEATNSMNKNESDLIEKDLNDALQNAKALESA
AVSLDGILSKAQYHLKIGSSEQRTSCRATADQLCGEVERIQNLLGTKQSEADALAVLKKA
FQDQKEELLKSIEDIEERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEHELCWLKDKA
KQIAQKDVAFAPEVDREINRLEVTWDDTKRLIHENQGQCCGLIDLMREYQNLKSAVSKVL
ENASSVIVTRTTIKDQEDLKWAFSKHETAKNKMNYKQKDLDNFTSKGKHLLSELKKIHSS
DFSLVKTDMESTVDKWLDVSEKLEENMDRLRVSLSIWDDVLSTRDEIEGWSNNCVPQMAE
NISNLDNHLRAEELLKEFESEVKNKALRLEELHSKVNDLKELTKNLETPPDLQFIEADLM
QKLEHAKEITEVAKGTLKDFTAQSTQVEKFINDITTWFTKVEESLMNCAQNETCEALKKV
KDIQKELQSQQSNISSTQENLNSLCRKYHSAELESLGRAMTGLIKKHEAVSQLCSKTQAS
LQESLEKHFSESMQEFQEWFLGAKAAAKESSDRTGDSKVLEAKLHDLQNILDSVSDGQSK
LDAVTQEGQTLYAHLSKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDCASELGSFED
QHRKLNLWIHEMEERFNTENLGESKQHIPEKKNEVHKVEMFLGELLAARESLDKLSQRGQ
LLSEEGHGAGQEGRLCSQLLTSHQNLLRMTKEKLRSCQVALQEHEALEEALQSMWFWVKA
IQDRLACAESTLGSKDTLEKRLSQIQDILLMKGEGEVKLNMAIGKGEQALRSSNKEGQRV
IQTQLETLKEVWADIMSSSVHAQSTLESVISQWNDYVERKNQLEQWMESVDQKIEHPLQP
QPGLKEKFVLLDHLQSILSEAEDHTRALHRLIAKSRELYEKTEDESFKDTAQEELKTQFN
DIMTVAKEKMRKVEEIVKDHLMYLDAVHEFTDWLHSAKEELHRWSDMSGDSSATQKKLSK
IKELIDSREIGASRLSRVESLAPEVKQNTTASGCELMHTEMQALRADWKQWEDSVFQTQS
CLENLVSQMALSEQEFSGQVAQLEQALEQFSALLKTWAQQLTLLEGKNTDEEIVECWHKG
QEILDALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYNCLCLQASKGCQNKE
QILQQRFRKAFRDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLSESENGQHKLN
MMLSKGELLSTLLTKEKAKGIQAKVTAAKEDWKNFHSNLHQKESALENLKIQMKDFEVSA
EPIQDWLSKTEKMVHESSNRLYDLPAKRREQQKLQSVLEEIHCYEPQLNRLKEKAQQLWE
GQAASKSFRHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQDWMTDAIHM
LDSYCHPTSDKSVLDSRTLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSPEGIPTIQQQ
LQSVKDMWASLLSAGIRCKSQLEGALSKWTSYQDGVRQFSGWMDSMEANLNESERQHAEL
RDKTTMLGKAKLLNEEVLSYSSLLETIEVKGAGMTEHYVTQLELQDLQERYRAIQERAKE
AVTKSEKLVRLHQEYQRDLKAFEVWLGQEQEKLDQYSVLEGDAHTHETTLRDLQELQVHC
AEGQALLNSVLHTREDVIPSGIPQAEDRALESLRQDWQAYQHRLSETRTQFNNVVNKLRL
MEQKFQQVDEWLKTAEEKVSPRTRRQSNRATKEIQLHQMKKWHEEVTAYRDEVEEVGARA
QEILDESHVNSRMGCQATQLTSRYQALLLQVLEQIKFLEEEIQSLEESESSLSSYSDWYG
STHKNFKNVATKIDKVDTVMMGKKLKTLEVLLKDMEKGHSLLKSAREKGERAVKYLEEGE
AERLRKEIHDHMEQLKELTSTVRKEHMTLEKGLHLAKEFSDKCKALTQWIAEYQEILHVP
EEPKMELYEKKAQLSKYKSLQQTVLSHEPSVKSVREKGEALLELVQDVTLKDKIDQLQSD
YQDLCSIGKEHVFSLEAKVKDHEDYNSELQEVEKWLLQMSGRLVAPDLLETSSLETITQQ
LAHHKAMMEEIAGFEDRLNNLQMKGDTLIGQCADHLQAKLKQNVHAHLQGTKDSYSAICS
TAQRMYQSLEHELQKHVSRQDTLQQCQAWLSAVQPDLEPSPQPPLSRAEAIKQVKHFRAL
QEQARTYLDLLCSMCDLSNASVKTTAKDIQQTEQTIEQKLVQAQNLTQGWEEIKHLKSEL
WIYLQDADQQLQNMKRRHSELELNIAQNMVSQVKDFVKKLQSKQASVNTIIEKVNKLTKK
EESPEHKEINHLNDQWLDLCRQSNNLCLQREEDLQRTRDYHDCMNVVEVFLEKFTTEWDN
LARSDAESTAVHLEALKKLALALQERKYAIEDLKDQKQKMIEHLNLDDKELVKEQTSHLE
QRWFQLEDLIKRKIQVSVTNLEELNVVQSRFQELMEWAEEQQPNIAEALKQSPPPDMAQN
LLMDHLAICSELEAKQMLLKSLIKDADRVMADLGLNERQVIQKALSDAQSHVNCLSDLVG
QRRKYLNKALSEKTQFLMAVFQATSQIQQHERKIMFREHICLLPDDVSKQVKTCKSAQAS
LKTYQNEVTGLWAQGRELMKEVTEQEKSEVLGKLQELQSVYDSVLQKCSHRLQELEKNLV
SRKHFKEDFDKACHWLKQADIVTFPEINLMNESSELHTQLAKYQNILEQSPEYENLLLTL
QRTGQTILPSLNEVDHSYLSEKLNALPRQFNVIVALAKDKFYKVQEAILARKEYASLIEL
TTQSLSELEAQFLRMSKVPTDLAVEEALSLQDGCRAILDEVAGLGEAVDELNQKKEGFRS
TGQPWQPDKMLHLVTLYHRLKRQTEQRVSLLEDTTSAYQEHEKMCQQLERQLKSVKEEQS
KVNEETLPAEEKLKMYHSLAGSLQDSGIVLKRVTIHLEDLAPHLDPLAYEKARHQIQSWQ
GELKLLTSAIGETVTECESRMVQSIDFQTEMSRSLDWLRRVKAELSGPVYLDLNLQDIQE
EIRKIQIHQEEVQSSLRIMNALSHKEKEKFTKAKELISADLEHSLAELSELDGDIQEALR
TRQATLTEIYSQCQRYYQVFQAANDWLEDAQELLQLAGNGLDVESAEENLKSHMEFFSTE
DQFHSNLEELHSLVATLDPLIKPTGKEDLEQKVASLELRSQRMSRDSGAQVDLLQRCTAQ
WHDYQKAREEVIELMNDTEKKLSEFSLLKTSSSHEAEEKLSEHKALVSVVNSFHEKIVAL
EEKASQLEKTGNDASKATLSRSMTTVWQRWTRLRAVAQDQEKILEDAVDEWTGFNNKVKK
ATEMIDQLQDKLPGSSAEKASKAELLTLLEYHDTFVLELEQQQSALGMLRQQTLSMLQDG
AAPTPGEEPPLMQEITAMQDRCLNMQEKVKTNGKLVKQELKDREMVETQINSVKCWVQET
KEYLGNPTIEIDAQLEELQILLTEATNHRQNIEKMAEEQKEKYLGLYTILPSELSLQLAE
VALDLKIRDQIQDKIKEVEQSKATSQELSRQIQKLAKDLTTILTKLKAKTDNVVQAKTDQ
KVLGEELDGCNSKLMELDAAVQKFLEQNGQLGKPLAKKIGKLTELHQQTIRQAENRLSKL
NQAASHLEEYNEMLELILKWIEKAKVLAHGTIAWNSASQLREQYILHQTLLEESKEIDSE
LEAMTEKLQYLTSVYCTEKMSQQVAELGRETEELRQMIKIRLQNLQDAAKDMKKFEAELK
KLQAALEQAQATLTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVQAVQLCQSALRIPEDV
VASLPLCHAALRLQEEASRLQHTAIQQCNIMQEAVVQYEQYEQEMKHLQQLIEGAHREIE
DKPVATSNIQELQAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVE
GLAEGTEDLDGELLPTPSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSP
SPVANTDASVNQDIAYYQALSAERLQTDAAKIHPSTSASQEFYEPGLEPSATAKLGDLQR
SWETLKNVISEKQRTLYEALERQQKYQDSLQSISTKMEAIELKLSESPEPGRSPESQMAE
HQSFLQALMDEILMLQDEINELQSSLAEELVSESCEADPAEQLALQSTLTVLAERMSTIR
MKASGKRQLLEEKLNDQLEEQRQEQALQRYRCEADELDSWLLSTKATLDTALSPPKEPMD
MEAQLMDCQNMLVEIEQKVVALSELSVHNENLLLEGKAHTKDEAEQLAGKLRRLKGSLLE
LQRALHDKQLNMQQGTAQEKEESDVDLTATQSPGVQEWLAQARTTWTQQRQSSLQQQKEL
EQELAEQKSLLRSVASRGEEILIQHSAAETSGDAGEKPDVLSQELGMEGEKSSAEDQMRM
KWESLHQEFSTKQKLLQNVLEQEQEQVLYSRPNRLLSGVPLYKGDVPTQDKSAVTSLLDG
LNQAFEEVSSQSGGAKRQSIHLEQKLYDGVSATSTWLDDVEERLFVATALLPEETETCLF
NQEILAKDIKEMSEEMDKNKNLFSQAFPENGDNRDVIEDTLGCLLGRLSLLDSVVNQRCH
QMKERLQQILNFQNDLKVLFTSLADNKYIILQKLANVFEQPVAEQIEAIQQAEDGLKEFD
AGIIELKRRGDKLQVEQPSMQELSKLQDMYDELMMIIGSRRSGLNQNLTLKSQYERALQD
LADLLETGQEKMAGDQKIIVSSKEEIQQLLDKHKEYFQGLESHMILTETLFRKIISFAVQ
KETQFHTELMAQASAVLKRAHKRGVELEYILETWSHLDEDQQELSRQLEVVESSIPSVGL
VEENEDRLIDRITLYQHLKSSLNEYQPKLYQVLDDGKRLLISISCSDLESQLNQLGECWL
SNTNKMSKELHRLETILKHWTRYQSESADLIHWLQSAKDRLEFWTQQSVTVPQELEMVRD
HLNAFLEFSKEVDAQSSLKSSVLSTGNQLLRLKKVDTATLRSELSRIDSQWTDLLTNIPA
VQEKLHQLQMDKLPSRHAISEVMSWISLMENVIQKDEDNIKNSIGYKAIHEYLQKYKGFK
IDINCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQILQGLVTEKIQLL
EGLLESWSEYENNVQCLKTWFETQEKRLKQQHRIGDQASVQNALKDCQDLEDLIKAKEKE
VEKIEQNGLALIQNKKEDVSSIVMSTLRELGQTWANLDHMVGQLKILLKSVLDQWSSHKV
AFDKINSYLMEARYSLSRFRLLTGSLEAVQVQVDNLQNLQDDLEKQERSLQKFGSITNQL
LKECHPPVTETLTNTLKEVNMRWNNLLEEIAEQLQSSKALLQLWQRYKDYSKQCASTVQQ
QEDRTNELLKAATNKDIADDEVATWIQDCNDLLKGLGTVKDSLFFLHELGEQLKQQVDAS
AASAIQSDQLSLSQHLCALEQALCKQQTSLQAGVLDYETFAKSLEALEAWIVEAEEILQG
QDPSHSSDLSTIQERMEELKGQMLKFSSMAPDLDRLNELGYRLPLNDKEIKRMQNLNRHW
SLISSQTTERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAH
ELFQAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGI
IDSQIRQWQRYREMAEKLRKWLVEVSYLPMSGLGSVPIPLQQARTLFDEVQFKEKVFLRQ
QGSYILTVEAGKQLLLSADSGAEAALQAELAEIQEKWKSASMRLEEQKKKLAFLLKDWEK
CEKGIADSLEKLRTFKKKLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLSLLKDT
LSAYISADDISILNERVELLQRQWEELCHQLSLRRQQIGERLNEWAVFSEKNKELCEWLT
QMESKVSQNGDILIEEMIEKLKKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEY
KLGKVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDSC
NSEEIQRKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLD
RRWRNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKSSERTAAFPSSSGVIYTVAKE
ELKKFEAFQRQVHECLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQRWDNLQKRVT
SILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEIS
LNHNKIEQIIAQGEQLIEKSEPLDAAIIEEELDELRRYCQEVFGRVERYHKKLIRLPLPD
DEHDLSDRELELEDSAALSDLHWHDRSADSLLSPQPSSNLSLSLAQPLRSERSGRDTPAS
VDSIPLEWDHDYDLSRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSDVMIPESPEAYV
KLTENAIKNTSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYM
KLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWELLQAQALSKELR
MKQNLQKWQQFNSDLNSIWAWLGDTEEELEQLQRLELSTDIQTIELQIKKLKELQKAVDH
RKAIILSINLCSPEFTQADSKESRDLQDRLSQMNGRWDRVCSLLEEWRGLLQDALMQCQI
FTGQVGRPFLNIKGFHEMSHGLLLMLENIDRRKNEIVPIDSNLDAEILQDHHKQLMQIKH
ELLESQLRVASLQDMSCQLLVNAEGTDCLEAKEKVHVIGNRLKLLLKEVSRHIKELEKLL
DVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQKTPRGKCSLSQPGPSVSSPHSRST
KGGSDSSLSEPGPGRSGRGFLFRVLRAALPLQLLLLLLIGLACLVPMSEEDYSCALSNNF
ARSFHPMLRYTNGPPPL
Download sequence
Identical sequences XP_016866100.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]