SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_016875801.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_016875801.1.92137
Domain Number 1 Region: 539-750
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-46
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 223-367
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 876-1028
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-33
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 4 Region: 123-225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.2e-27
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 736-860
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 6 Region: 42-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-23
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_016875801.1.92137
Sequence length 1045
Comment PREDICTED: FERM, RhoGEF and pleckstrin domain-containing protein 1 isoform X2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAG
EPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHL
SELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDK
AYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTNFLK
EIEQRLALWEGRSNAQIRDYQRIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRR
LENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEI
TEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGREFIRLGSLSKLSGKGLQQRMFF
LFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASS
RSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKSPDEATAADQESEDDLSASRTSL
ERQAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFC
LFFYKSHQDNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERW
MEVIRSATSSASRPHVLSHKESLVY
Download sequence
Identical sequences Q9Y4F1
9606.ENSP00000322926 ENSP00000322926 gi|5031633|ref|NP_005757.1| NP_005757.1.87134 NP_005757.1.92137 XP_016875801.1.92137 ENSP00000322926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]