SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017052536.1.74164 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017052536.1.74164
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-29
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily L27 domain 2.24e-21
Family L27 domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017052536.1.74164
Sequence length 195
Comment PREDICTED: protein lin-7 homolog C [Drosophila ficusphila]; AA=GCF_000220665.1; RF=representative genome; TAX=30025; STAX=30025; NAME=Drosophila ficusphila; AL=Scaffold; RT=Major
Sequence
MADNAEPLTLSRDVKRSIELLEKLQASGDFPTTKLAALQKVLNSEFMTSVREVYEHVYET
VDIQGSHDVRASATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEE
MEMRFDKQRNTRRRQ
Download sequence
Identical sequences A0A1W4VKD7
XP_017005247.1.47939 XP_017052536.1.74164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]