SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017179897.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017179897.1.92800
Domain Number 1 Region: 106-156
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000196
Family B3 DNA binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017179897.1.92800
Sequence length 173
Comment PREDICTED: uncharacterized protein LOC103406250 [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MDFMQRDQKGYSDKEDQDQEQEDQEEEEDIITTSNSNYGSSPKYKGILLPPPPPHYHQQY
GRQKPWLDVQNHGSPEAINFTDLSLNKDQVSDGGTDQNYWPPNSEREHMFDKVVTPSDVG
KLNRLVIPKQHAERYFPLDSSSNDKGLLLNFQDRTGSRGGLXTLIGIAARAMS
Download sequence
Identical sequences MDP0000128295|PACid:22625136 MDP0000128295 XP_017179897.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]