SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017185933.1.92800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017185933.1.92800
Domain Number 1 Region: 142-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.83e-33
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017185933.1.92800
Sequence length 271
Comment PREDICTED: auxin response factor 2 [Malus domestica]; AA=GCF_000148765.1; RF=representative genome; TAX=3750; STAX=3750; NAME=Malus domestica; cultivar=Golden Delicious; AL=Chromosome; RT=Major
Sequence
MALRTAGVEGLPYTTSVNARESSGCTDAAAAPAANNNQGEKDDLYHQLWLSCAGANVYIS
RPGEKVFYFLQGHMEQVEAYANQDGKLEMPRYNLPSKILCNVVSVQLKAEAHTDEVYARI
TLLPVIEEDQLSVEEENTPTLPRRTSTRSFSKTLTPSDTSTHGGFSVPKRIADECFPPLD
MSQQPPVQDLVAKDLQGYEWHFRHVYRGQPKRHLLTNDWSTFVAAKRLVAGDACIFARTS
PAAFILPFDQYMESAEIDNSIGMRFKMLNLL
Download sequence
Identical sequences XP_017185933.1.92800 MDP0000138853 MDP0000138853|PACid:22674896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]