SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017290988.1.84151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017290988.1.84151
Domain Number 1 Region: 59-297
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.94e-91
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 2190-2304
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-36
Family Pleckstrin-homology domain (PH domain) 0.00000353
Further Details:      
 
Domain Number 3 Region: 316-437
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-35
Family Spectrin repeat 0.0000666
Further Details:      
 
Domain Number 4 Region: 1667-1821
Classification Level Classification E-value
Superfamily Spectrin repeat 5.52e-30
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 1031-1186
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-29
Family Spectrin repeat 0.0000273
Further Details:      
 
Domain Number 6 Region: 1560-1716
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-29
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 660-765
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-27
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 1244-1397
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-27
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 9 Region: 1879-2033
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 10 Region: 836-972
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 11 Region: 446-546
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 12 Region: 768-869
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-21
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 13 Region: 550-658
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-21
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 14 Region: 1405-1503
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-16
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 15 Region: 2015-2099
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000107
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017290988.1.84151
Sequence length 2368
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1-like isoform X1 [Kryptolebias marmoratus]; AA=GCF_001649575.1; RF=representative genome; TAX=37003; STAX=37003; NAME=Kryptolebias marmoratus; AL=Scaffold; RT=Major
Sequence
MELQSATGPLPGSLSPLSPTSDYPGPLMSPSSGGPGPSLSPTRRSSPDPGFSGQAAFNYN
QLEGRFKQLQDEREAVQKKTFTKWVNSHLSRVSCRITDLYMDLRDGRMLIKLLEVLSGER
LPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQI
QDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDL
IDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSK
MKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQ
QLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERL
EKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEA
ATKKHEAIETDIAAYEERVQAVVAVAKELEAESYHDIKRITARKDNVIRLWEYLLELLKA
RRLRLELNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGI
QVDRVRNVNSNAQRFATDSDGYKPCDPQIIRDRVAHLEFCYQELTQLAAERRARLEESRR
LWKFFWEMAEEEGWIKEKEQILSSEDYGKDLTGAVRLLSQHKAFEDEMSGRAAHLQQTIK
QGDELVADNHFGAEKIKERIRDIQEQWAALERLSAVRKARLQEAVNQHQFQADADDIDTW
MLDVLRIVSSVDVGHDEFSTQALVKKHKDVAEEIESYRPVIEALHDQARTLPPEKADSEE
VQSRLAGIEERYREVVELTRLRKQALQDALALYKMLSEARACELWIDEKEQWLNSMEIPE
KLEDLEVVQHRFESLEPEMNSQASRVAVVNQVARQLIHSGHPSEKEIKAQQDKLNTRWSQ
FRDLVDQKKENLNSALGVQNYHLECNETKSWIKEKTKVIESTQELGNDLAGVMALQRKLT
GMERDLVAIEDKLSDLGKEAERLASEHPEQSEAITGRLAEITGVWDEMKDSLKNREESLG
EASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEVRNYEEDYQ
KMRDMGEMVTRGQTDAQHMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTK
QAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKISGVVDAGCRLVADG
NVNAERIQEKVDSIDQRRKKNRQAANDLLARLKDNRDLQKFLQDCQELSLWINEKMLTAQ
DMTYDEARNLHSKWLKHQAFMAELQSNKEWLDKIKKDGQTLMAEKPDTEAMVKEKLASLT
SMWDDLESTTQTKAKCLFDANKAELFTQSCADLDKWLTGLDGQLQSDDYGKDLTSVNILL
KKQQMLESQVEVRQKEVEELQRQSQALSQEGKGSDEVDGQRISVEHKFHTLQAPLQKRRD
NLMASREIHQFNRDVEDEILWVEERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQP
RYDDIFERSQHILREGSPTAELIRQRLADLQSLWEQIKKETEKRHSRLSEAHKAQQYYFD
AAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYADAVHQLSSTSRGLVA
AGHPDSERIGMRQSQVDKLYAGLKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVV
AGSHELGQDYEHVTMLQERFREFARDTGTIGQERVDGVNRLADELINSGHGDAATIAEWK
DGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILNRILDKHKKLPEELGRDQNTVE
TLQRMHTTFEHDIQALGTQVRQLQEDAVRLQSAYAGDKADDIQKREGEVLEAWKNLLEAA
EGRRAKLADTGDKFRFFSMVRDLMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEI
DARNDSFTACIELGKALLARKHYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVH
QFSRDAGVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHESFEKSAATWEERFSALERLT
TMELLEVRRRQEEEERKRQPAEAADAAAQHREGEPVSQNGLPSEQESPREAVDGADVVNG
VSGPSPSGSPGASRKGKPSQAATLPAKTQQDAPVPQMEGFLHRKHEWEGHNKKASNRSWH
NVYCVINHQEMGFYKDQKSAGQGIPYHSEIPVSLKDAVCEVAVDYKKKKHVFKLKITDGN
EYLFQAKDDEEMNTWISKISAAMAGEKSEVTPSGHSTPAPAPAARAQTLPASVAATAAAA
ATTTAAESSPGKREKDKEKRFSLFSKKK
Download sequence
Identical sequences XP_017290988.1.84151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]