SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017367172.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017367172.1.71028
Domain Number 1 Region: 125-219
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.31e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 18-112
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.28e-33
Family VPS28 N-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017367172.1.71028
Sequence length 221
Comment PREDICTED: vacuolar protein sorting-associated protein 28 homolog [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDC
VSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKD
DKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTV
SQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences A0A2K5S831 A0A2K6SUJ0 G3SD56 K7CGH9 Q548N1 Q9UK41 U3EZY3
ENSP00000292510 ENSP00000434064 ENSP00000457919 ENSP00000292510 ENSP00000434064 GO.36858 HR193 hss001000249.1 hss001000249.2 NP_057292.1.87134 NP_057292.1.92137 XP_003819469.1.60992 XP_010328151.1.74449 XP_010328152.1.74449 XP_016815627.1.37143 XP_017367171.1.71028 XP_017367172.1.71028 XP_018887733.1.27298 gi|7705885|ref|NP_057292.1| Hs7705885___KOG3284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]