SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017369828.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017369828.1.71028
Domain Number 1 Region: 684-830
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1010-1109
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-29
Family Ras-binding domain, RBD 0.00082
Further Details:      
 
Domain Number 3 Region: 216-372
Classification Level Classification E-value
Superfamily PH domain-like 5.97e-22
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 
Domain Number 4 Region: 13-98
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-19
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 955-1024
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000568
Family Ras-binding domain, RBD 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017369828.1.71028
Sequence length 1437
Comment PREDICTED: regulator of G-protein signaling 12 isoform X1 [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MYRAGEAAKRPLPGPTPLRVRSVEVARGRAGYGFTLSGQAPCVLSCVMRGSPADFVGLRA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGIGHFESCSSDEEGGLYEGKGWL
KPKLDSKALGINRAERVVEELQSGGIFNMIFENPSLSASSSEPLRLKQRSLSESAAARFD
VGHESVNNPNPSMLSKEEISKVIHDDSVFSIGLEGHDDFALDASILNVAMIVGYLGSIEL
PSTSSNLESDSLQAIRGCMRRLRAEQKIHSLVTMKIMHDCVQLGTDKAGVVAEYPAEKLA
FSAVCPDDRRFFGLVTMQTNDDGSLAQEEEGALRTSCHVFMVDPDLFHHKIHQGIARRFG
FECTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAQQNNSTSS
NSDSGIGNFNQEEKSNRVLVVDLGGSSSRHGPGGSAWDGVGGRGAQPWGIPWTAPFCPDP
EGSPPFEAAHQTDRFRDLSKHLGPASPVELPPTSSRSSVPPSKRGTVGASSAFNQRWLPV
HVLREWQCGHTSDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSAPKREWSRKAF
GMQNIFGPHRNVRKTKEDKKGSKFGRGIGLTQPSPRTPARRSFGRSKRFSITRSLDDLES
ATVSDGELTGADLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPVGVR
YFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDVLRAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRALPDSQEV
PSSPASKHSLGSEHSSVSTPKKLNGKSKSGRSLNEELGDEDSEKKRKGAFFLWSRTRSTG
RSQKKREHGDHTDDPLHANGGLCRRESQGSVSSAGSLDLSEACRTLAPEKDKATKHCCIH
LPDGTSCVVAVKAGFSIKEILSGLCERHGINGAAADLFLVGGDKPLVLHQDSSILESRDL
RLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGGLLVRLSGEKEPLDL
GAPISSLDGQRVVLEEKDPSRGKASTDKQKGAPVKQNTAINSSSRNHSATGEERTLGKSN
SIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADDQRG
LLRKEDLVLPEFLRLPPGSTELTLPTAAAMAKGFSKRGATGSGRESASQPSEQWEPAQES
SDSLSTSPGSAPSPPGTTSPGQKSPSGAFCTPQSPSSLEQEGTTQIWKRQSREVEARGIQ
TVEDEHVAELTLMGEGDISSPNSTLLPPPSAPQDALEPSRPGSRAHSSRGLPGNRIIDVD
LVTGSAPGRGGCTMGAWAGPGRSQVSSESPASDLPSLSPVPGEPAKPKASTHHATFV
Download sequence
Identical sequences A0A2K5QZP0
XP_017369828.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]