SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017389481.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017389481.1.71028
Domain Number 1 Region: 29-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-34
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 2172-2291
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-33
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 3.12e-29
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 6.79e-29
Family Spectrin repeat 0.00027
Further Details:      
 
Domain Number 6 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 4.89e-28
Family Spectrin repeat 0.00000216
Further Details:      
 
Domain Number 7 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-27
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 8 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-24
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 1532-1672
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-23
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 10 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-22
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 11 Region: 425-525
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-22
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 2.4e-19
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 13 Region: 530-636
Classification Level Classification E-value
Superfamily Spectrin repeat 3.68e-18
Family Spectrin repeat 0.00069
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1386-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000196
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017389481.1.71028
Sequence length 2328
Comment PREDICTED: spectrin beta chain, erythrocytic [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEKENYHDQKRITARKDNILRLWSYLQELLRSRRQRLETTLVLQKLFQDMLHS
INWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGEKVKAITSATLKFTEGNGY
QPCDPQVIHDRISHLEQCFGELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLDHIFQEARGMVARKQFGHPQIEARIKE
VSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEKQAQGFPEEFRDSPDVTNRLQVLRELYQQVVAQADLR
RQRLQEALDLYTVFGETDACELWMGEKEKWLAQMEMPDTLEDLEVVQHRFDILDQEMKTL
MTQIDGVNLAANSLVESGHPRSGEVKRYQDHLNTRWQAFQTLVLKRREAVDSALRVHNYC
VDCEETSKWITDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQARVDALERESQQ
LMDSHPEQKEDIGQRQKHLEELWQGLQQALQGQEASLGEASQLQAFLQDLDDFGAWLSIA
QKAVASEDMPESLPEAEQLLQQHAAIKDEIDGHQESYQHVKESGEKVIRGQTDPEYLLLG
QRLEGLDTGWDALDRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLVSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKND
EKAQEATVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASYEGWLENIDAEGKQLMEEKPQFAALVSQRLKALHLLWDELQATTKEKTQRLSAARS
SDLRLQTHADLNKWISTMEDQLRSDDPGKDLTSVNRMLAKLKRVEDQVNVRKEELGELFA
QVPSMGEEAGDTDLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSADYGTNLQTVQLFMKKNQTLQNEILGHTPRIEDVLQRGQQLVEAAEIDCQDLEERLG
HLQSSWDRLREAAVGRLQRLRDANEAQQYYLDAGEAEAWIGEQELYVISDETPKDEEGAI
VMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDMAE
ERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETG
AIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
SIIRQIETQERPRDVSSVELLMKYHQGISAEIETRSKNFSACLELGESLLQRQHQASEEI
REKLQQVVSRRKEMNERWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQMAERPAEETGLQEEEGETAG
EAPVSHQAATERTSPGEEEGRWPKDLQQPPPPGQHEDRQKSIGDERPATEPLFKVLDTPL
SEGDEPTTLLAPRDRGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTFYKD
AKNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEMLSWL
RGVSTAINESQSIRVKAQSLPLPALSGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences A0A2K5PFE4
XP_017389479.1.71028 XP_017389480.1.71028 XP_017389481.1.71028 XP_017389482.1.71028 XP_017389483.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]