SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017392431.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017392431.1.71028
Domain Number 1 Region: 644-899
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-53
Family YWTD domain 0.00000564
Further Details:      
 
Domain Number 2 Region: 32-292
Classification Level Classification E-value
Superfamily YWTD domain 1.11e-51
Family YWTD domain 0.00000168
Further Details:      
 
Domain Number 3 Region: 343-573
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-51
Family YWTD domain 0.00000266
Further Details:      
 
Domain Number 4 Region: 946-1203
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-37
Family YWTD domain 0.0000725
Further Details:      
 
Domain Number 5 Region: 1334-1369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1296-1332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000567
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 1256-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 9 Region: 902-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000677
Family EGF-type module 0.026
Further Details:      
 
Domain Number 10 Region: 298-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1213-1265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000986
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017392431.1.71028
Sequence length 1614
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MEAAPPRPPWPLLLLLLVLVLCGCPAPAAASPLLLFANRRDVRLVDAGRVKLETTVVVSG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNHTGVAVQNVVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALNPAHGYMYWTDWGEMPRIERAGM
DGSTRNIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKRTGGKRKEILSALYSPMDIQVLSQERQPFFHTRCEE
DNGGCSHLCLLSPMEPFYTCACPTGVQLQDNGRTCKAGAEEVLLLARRTDLRRISLDTPD
FTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLINTEINDPDGI
AVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPVMGLMYWTDWGEN
PKIECANLDGQERRVLVNASLGWPNGLALDLQEGKLYWGDTKMDKIEVINVDGTKRRTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQLPDLMGLKAVNVAKIIG
TNPCADENGGCSHLCFFTPHSTRCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLE
TNNNDVAIPLTGVKEASALDFDVANNHIYWTDVSLKVXXXAFLNGSSVEHVVEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTEGYIYWTEWG
GKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYTDQRLYWTDLDTNMIESSNMLGQERVVI
ADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQD
GLNDCVHDNGQCGQLCLAIPGGHRCGCASHYTLDPSGRNCSPPSTFLLFSQKSAISRMIP
DDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSLSQAQN
PDRQPHDLSIDIYSRTLFWTCEATNTINVHRLSGEAMGVVLRGDRDKPRAIIVNAERGYL
YFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNALGKLFWADADLKRIESCDL
SGANRLTLEDANIVQPLGLTVLGKHLYWIDRQQQMIERVEKTTGDKRTRIQGRVTHLTGI
HAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSP
DQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEA
DCQDRSDEADCDAICLPNQFRCANGQCVLIKQQCDSFPDCIDGSDELMCEINKPPSDDTG
AHSSAIGPVIGIILSLFVMGGIYFVCQRVVCQRYAGASGPFPHEYVGGTPHVPLNFIAPG
GSQHGPFTGIACGKSVMSSVSLMGGRSGVPLYDRNHVTGASSSSSSSTKATLYPPILNPP
PSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASK
YYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences XP_017392431.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]