SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017443655.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017443655.1.4139
Domain Number 1 Region: 7-292
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-80
Family Protein kinases, catalytic subunit 0.00000419
Further Details:      
 
Domain Number 2 Region: 735-922
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-49
Family Nucleotide and nucleoside kinases 0.000000038
Further Details:      
 
Domain Number 3 Region: 607-725
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-33
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 474-574
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 341-393
Classification Level Classification E-value
Superfamily L27 domain 6.18e-21
Family L27 domain 0.0000634
Further Details:      
 
Domain Number 6 Region: 403-454
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000459
Family L27 domain 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017443655.1.4139
Sequence length 926
Comment PREDICTED: peripheral plasma membrane protein CASK isoform X16 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR
QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHAL
TDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP
ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDM
DMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREIN
GISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNS
VSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK
LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVF
DQLDLVTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPERFAYPIPHTTRPPKK
DEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQ
ALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDVLQRTYAHYFDLTIINNEID
ETIRHLEEAVELVCTAPQWVPVSWVY
Download sequence
Identical sequences 10116.ENSRNOP00000063381 ENSRNOP00000060804 XP_017443655.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]