SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017444511.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017444511.1.4139
Domain Number 1 Region: 60-97
Classification Level Classification E-value
Superfamily Ribosomal protein L36 0.0000000000000124
Family Ribosomal protein L36 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017444511.1.4139
Sequence length 97
Comment PREDICTED: 39S ribosomal protein L36, mitochondrial [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MAALFVRSVVASVVDLSRLAVKPRAFSILLGTLPSAKPCAEVRSLLCGGPVLSLQPSLGF
KTKGVIKKRCRDCYMVKRRGRWFVLCKTNPKHKQRQM
Download sequence
Identical sequences B2RZ39
NP_001102349.1.100692 XP_003748731.1.100692 XP_003753204.1.4139 XP_006222939.1.4139 XP_006222940.1.4139 XP_006222941.1.4139 XP_006227824.1.100692 XP_006227825.1.100692 XP_006227826.1.100692 XP_006227827.1.100692 XP_006227864.1.100692 XP_006227865.1.100692 XP_006227866.1.100692 XP_017444511.1.4139 XP_017444951.1.100692 XP_017445366.1.100692 ENSRNOP00000032662 ENSRNOP00000032662 ENSRNOP00000067146 10116.ENSRNOP00000032662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]