SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017444942.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017444942.1.100692
Domain Number 1 Region: 363-770
Classification Level Classification E-value
Superfamily ALDH-like 7.85e-90
Family ALDH-like 0.000000101
Further Details:      
 
Domain Number 2 Region: 71-353
Classification Level Classification E-value
Superfamily Carbamate kinase-like 1.83e-50
Family PyrH-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017444942.1.100692
Sequence length 795
Comment PREDICTED: delta-1-pyrroline-5-carboxylate synthase isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MLRHVQRSGLQPFSQRLLPWVQSIALPRSHRVQPSAIRHVRSWSNIPFITVPLSRAHGKP
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGLGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAG
PTVEQQGEMARSGGRMLATLEPEQRAEIINHLADLLTDQREEILLANKKDLEEAEGRLAG
PLLKRLSLSTSKLNSLAIGLRQIAASSQESVGRVLRRTRIAKNLELEQVTVPIGVLLVIF
ESRPDCLPQVAALAIASGNGLLLKGGKEAMHSNRILHLLTQEALSIHGVKEAIQLVNTRE
EVEDLCRLDKIIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRL
VRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSE
VKSLRTEYGDLEVCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVF
WNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGRL
KYLHENLPVPQRHFS
Download sequence
Identical sequences D3ZIE9
ENSRNOP00000020940 NP_001101994.1.100692 NP_001101994.1.4139 XP_006231406.1.100692 XP_006231407.1.100692 XP_017444942.1.100692 10116.ENSRNOP00000020940 ENSRNOP00000020940 ENSRNOP00000064584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]