SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017577400.1.86671 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017577400.1.86671
Domain Number 1 Region: 26-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.25e-90
Family Calponin-homology domain, CH-domain 0.000000743
Further Details:      
 
Domain Number 2 Region: 2172-2287
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-36
Family Pleckstrin-homology domain (PH domain) 0.00000409
Further Details:      
 
Domain Number 3 Region: 294-415
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 1010-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-30
Family Spectrin repeat 0.0000209
Further Details:      
 
Domain Number 5 Region: 1645-1799
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-29
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 602-741
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-28
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 7 Region: 1538-1694
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-27
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 8 Region: 1857-2011
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 9 Region: 1222-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 5.55e-27
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 10 Region: 816-950
Classification Level Classification E-value
Superfamily Spectrin repeat 2.66e-25
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 11 Region: 424-527
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-23
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 12 Region: 528-636
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-21
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 13 Region: 745-847
Classification Level Classification E-value
Superfamily Spectrin repeat 3.2e-19
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 14 Region: 1383-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-18
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 15 Region: 1984-2077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017577400.1.86671
Sequence length 2349
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X1 [Pygocentrus nattereri]; AA=GCF_001682695.1; RF=representative genome; TAX=42514; STAX=42514; NAME=Pygocentrus nattereri; AL=Scaffold; RT=Major
Sequence
MTTVAAEYDHMDIQQQYQDTVNNRWDEDWDNENSSARLFERSRIKALADEREAVQKKTFT
KWVNSHLARVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQ
FLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLL
WCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLA
EQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETE
KMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGN
LEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLE
QLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAV
VAVARELEAENYHDIKRITARKDNVLRLWDYLLELLKARRQRLEMNLGLQRVFQEMLYIM
DWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVRAVNANAQKFAVSGDGY
KPCDPQVILDRVAHLEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQIL
SSDDVGKDLTGAVRLLSQHRALEDEMSGRAGHLQHTVREGLAMADAGHFGEDRIRERVAE
VQAQWAALERLAAVRKARLEEACGLHQFQTDADDVDAWTLDALRIVSSGDVGHDEFSTQA
LVKKHKDAAAEVASYRPVIDALQEQGRALPPELAESADVSGRLVGIEERYKEVAELTRLR
KQALQDALALYKMFSEADACEVWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQ
ASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYH
LDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEAER
LAEEHPEQAKAITGRLAEIDAVWEEMKATLHNREASLGEASKLQQFLRELDDFQSWLSRT
QTAIASEDMPNTLAEAEKLLAQHEGIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLR
QRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTL
EGAEAAIKKQEDFMTTMDANEEKINSVVEAGRRLASDGNINAERIQERASSIDDRHKKNR
EAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMA
ELQSNKEWLDKIEKDGMQLVSEKPETEAVVKEKLATLQKQWQELESTTQTKAQCLFDANK
AELFTQSCADLDKWLGGLEGQIQSDDYGKDLTSVSILLKKQQMLENQVEVRKREVEELQS
QAHVLQQEGKDTDEVDRRRQVVEKKFQELLDPLMKRKNFLMASREIHQFNRDVEDEILWV
EERMPIATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKEDSPNVEV
IRARLDDLQTLWSLLIQETEKRHERLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAK
DEQSSVTMLKKHQILEQAVEDYAETVHQLSKTSRDLVAANHPESERIGMRQSQVDKLYAG
LKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFRE
FARDTGNIGQERVDAVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILA
ASYELHKFYHDAKEILSRILDKHKMLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQ
LQEDAVRLQSAYAGDKADDIQRRESEVLDAWRNLLEACEGRRTRLLDTGDKFRFFSMVRD
LMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTSCIELGKSLLARKH
YASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSS
REVGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTTMELLEVRRQQEEEERRRKPPT
PEPAQEIQEQQREGEQIAQNGLPSDQESPREGVDGEIVNGVPERSSKEPSPIPSPTSGRR
AKGSQSSTLPAKSQESPSAQLEGFLHRKHEWEGHNKKASNRSWHNVYCVINNQEMGFYKD
NKNAGQGIPYHNEIPVSLKDATCEVAVDYKKKKHVFKLRVTDGNEYLFQAKDDEDMNTWI
QAIQNATTGSSASEKSEITPSNQSTPASSRAQTLPATVTLTTESSPGKREKDKEKDKEKR
FSLFSKKKQ
Download sequence
Identical sequences XP_017577400.1.86671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]