SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017577401.1.86671 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017577401.1.86671
Domain Number 1 Region: 26-263
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-90
Family Calponin-homology domain, CH-domain 0.000000921
Further Details:      
 
Domain Number 2 Region: 2160-2275
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-36
Family Pleckstrin-homology domain (PH domain) 0.00000409
Further Details:      
 
Domain Number 3 Region: 282-403
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-36
Family Spectrin repeat 0.0000528
Further Details:      
 
Domain Number 4 Region: 998-1153
Classification Level Classification E-value
Superfamily Spectrin repeat 7.86e-30
Family Spectrin repeat 0.0000209
Further Details:      
 
Domain Number 5 Region: 1633-1787
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-29
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 590-729
Classification Level Classification E-value
Superfamily Spectrin repeat 2.28e-28
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 7 Region: 1526-1682
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-27
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 8 Region: 1845-1999
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-27
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 9 Region: 1210-1363
Classification Level Classification E-value
Superfamily Spectrin repeat 5.47e-27
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 10 Region: 804-938
Classification Level Classification E-value
Superfamily Spectrin repeat 2.66e-25
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 11 Region: 412-515
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-23
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 12 Region: 516-624
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-21
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 13 Region: 733-835
Classification Level Classification E-value
Superfamily Spectrin repeat 3.2e-19
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 14 Region: 1371-1469
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-18
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 15 Region: 1972-2065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000144
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017577401.1.86671
Sequence length 2337
Comment PREDICTED: spectrin beta chain, non-erythrocytic 1 isoform X2 [Pygocentrus nattereri]; AA=GCF_001682695.1; RF=representative genome; TAX=42514; STAX=42514; NAME=Pygocentrus nattereri; AL=Scaffold; RT=Major
Sequence
MDAEWGSGGDLYQGAGYTAQMPFNYNQLDGRFKQLQDEREAVQKKTFTKWVNSHLARVSC
RITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENM
GSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNV
NIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDP
EDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASD
LLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKM
RANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAM
RETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENY
HDIKRITARKDNVLRLWDYLLELLKARRQRLEMNLGLQRVFQEMLYIMDWMDEMKMLLLS
QDYGKHLLGVEDLLQKHALVEADIGIQADRVRAVNANAQKFAVSGDGYKPCDPQVILDRV
AHLEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDVGKDLTGA
VRLLSQHRALEDEMSGRAGHLQHTVREGLAMADAGHFGEDRIRERVAEVQAQWAALERLA
AVRKARLEEACGLHQFQTDADDVDAWTLDALRIVSSGDVGHDEFSTQALVKKHKDAAAEV
ASYRPVIDALQEQGRALPPELAESADVSGRLVGIEERYKEVAELTRLRKQALQDALALYK
MFSEADACEVWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIAR
QLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIRE
KTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEAERLAEEHPEQAKAI
TGRLAEIDAVWEEMKATLHNREASLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNT
LAEAEKLLAQHEGIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNE
LHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQED
FMTTMDANEEKINSVVEAGRRLASDGNINAERIQERASSIDDRHKKNREAAVELLMRLKD
NRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKI
EKDGMQLVSEKPETEAVVKEKLATLQKQWQELESTTQTKAQCLFDANKAELFTQSCADLD
KWLGGLEGQIQSDDYGKDLTSVSILLKKQQMLENQVEVRKREVEELQSQAHVLQQEGKDT
DEVDRRRQVVEKKFQELLDPLMKRKNFLMASREIHQFNRDVEDEILWVEERMPIATSTDH
GHNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKEDSPNVEVIRARLDDLQTLW
SLLIQETEKRHERLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVTMLKKH
QILEQAVEDYAETVHQLSKTSRDLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKL
DERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQER
VDAVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDA
KEILSRILDKHKMLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAVRLQSAY
AGDKADDIQRRESEVLDAWRNLLEACEGRRTRLLDTGDKFRFFSMVRDLMLWMEDVIRLI
EAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTSCIELGKSLLARKHYASEEIKEKLLQ
LTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSREVGQSVDEVEK
LIKRHEAFEKSAATWEERFSALERLTTMELLEVRRQQEEEERRRKPPTPEPAQEIQEQQR
EGEQIAQNGLPSDQESPREGVDGEIVNGVPERSSKEPSPIPSPTSGRRAKGSQSSTLPAK
SQESPSAQLEGFLHRKHEWEGHNKKASNRSWHNVYCVINNQEMGFYKDNKNAGQGIPYHN
EIPVSLKDATCEVAVDYKKKKHVFKLRVTDGNEYLFQAKDDEDMNTWIQAIQNATTGSSA
SEKSEITPSNQSTPASSRAQTLPATVTLTTESSPGKREKDKEKDKEKRFSLFSKKKQ
Download sequence
Identical sequences XP_017577401.1.86671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]