SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017578963.1.86671 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017578963.1.86671
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-55
Family YWTD domain 0.00000383
Further Details:      
 
Domain Number 2 Region: 180-427
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-52
Family YWTD domain 0.00000174
Further Details:      
 
Domain Number 3 Region: 783-1037
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-40
Family YWTD domain 0.0000516
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-26
Family YWTD domain 0.0000558
Further Details:      
 
Domain Number 5 Region: 1091-1129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000995
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1169-1207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 1131-1166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 437-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000894
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 9 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.047
Further Details:      
 
Domain Number 10 Region: 134-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000054
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 11 Region: 1049-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000229
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017578963.1.86671
Sequence length 1448
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 [Pygocentrus nattereri]; AA=GCF_001682695.1; RF=representative genome; TAX=42514; STAX=42514; NAME=Pygocentrus nattereri; AL=Scaffold; RT=Major
Sequence
MYWTDWGEEPRIERAGMDGSSRKVIVEEEIYWPNGLTIDLTEQKLYWADAKLSFIHRANL
DGTARETVVEGTLTHPFALTLFEETLYWTDWQTRSIHACNKHTGDNRREILNAIYSPMDI
QVLDQERQPYIHTPCSDSNGGCSHLCLLSPSPPFYSCACPTGVKLREDGKTCRPGAEQVL
LLARRTDLRRISLDLPDFTDIVLQVSDIRHAIAIDYDPVEGFVYWTDDEVRAIRRARLDG
SDAQTLITTEINHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTFRRILISERLSEPRAI
VLDPIHGYMYWTDWGEKPKIERANLDGSDRMVLVNSSLGWPNGLALDYATGKLYWGDAKT
DKIEVIDVDGSNRMVLLEDKLPHIFGFTLLGDYIYWSDWQRRSIERVHTTKAVREVIVEQ
LPDLMGLKATKVIETFGTNGCADSNGGCSHLCFFGPRGVSCACPMGLELLSDLRTCVVPE
AFLLFTNRAEIRSISLGTNSNDVAIPLTGVKEASALDFDVAENRIFWTDVSTKTISRAFM
NGSGVEAVIEFGLDYPEGMAVDWMGRNIYWADTGTNRIEVARLDGQYRQVLVCKDLDNPR
SLALDPSNGYMYWTEWGGRPRIARAHMDGTNIVTLVDKVGRANGLTIDYADQRLYWTDLD
TCMIESTNMQGLQREIVTDDLPHPFGLTQYRDYIYWTDWTLRSIERADKRSGLNRTVVQG
QLEYVMDILVFHSSRQDGSNECSHSNGHCAHLCLASPSGAQCRCASHYTLDPNGRNCSSP
SSFLLFSQRSSISRIVLGEQSPDMILPIHVLKNLRAISFDPLERLIYWVDGRQNIRRARD
DGSQVATVVSPSPNQQLKQPHDLSLDPFSRTVYWTCENTNTINIQRMDGQALGEVLKDDL
DKPRAIVVNAEKGYMYFTTLQDRSAKIEGASLDGTERESLFTTGLIRPVALALDNKLGKL
FWADADLKRIESSDLSGANRIVLQDSNILQPIGLTVLGDHLYWIDKLQQTIERVDKRSGE
KRTRIQGRIQYPTGIHAVEYMEPEEFASHPCSRDNGGCSHICIAKGDGTPRCSCPMHLVL
LQNLLSCGEPPTCSSEQFTCATGDIDCIPMAWRCDGIAECADHSDEMNCPMCSELQFQCD
KGQCVDAQLRCNGEPDCADGSDEQDCDTICMLNQFRCSNNKCILKKQQCDSYADCIDGSD
ELFCDFPPSQNDQRHTNTIGPVIGIILSVFVLGGMCFVCQRVVCRRYKGPNGGFPHDYIS
GTPHVPLNFIAPTNSQHGTFTGISCGKSMMSSVSLMGSSSSGAPLYDRNHVTGASSSSSS
STKANFYPQILNPPPSPATDRSLYNTEIFYSSNSPSTTRSYRPYVMRGVAPPTTPCSTDV
CDSDYTTSRWKSNKYYMDLNSDSDPYPPPPTPRSQYMSAEESCPPSPSTERSYFHLCPPP
PSPCTDSS
Download sequence
Identical sequences XP_017578963.1.86671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]