SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017644784.1.75545 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017644784.1.75545
Domain Number 1 Region: 35-211
Classification Level Classification E-value
Superfamily MIR domain 7.19e-56
Family MIR domain 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017644784.1.75545
Sequence length 220
Comment PREDICTED: stromal cell-derived factor 2-like protein [Gossypium arboreum]; AA=GCF_000612285.1; RF=representative genome; TAX=29729; STAX=29729; NAME=Gossypium arboreum; cultivar=Shixiya1; AL=Chromosome; RT=Major
Sequence
MAMGFLGFALFLFLSLDLDQGSPSSASAASSSSTSQNVEITYGTVLKLMHEKTKFRLHSH
DVPYGSGSGQQSVTGFPNVDDSNSYWIVRPEPDTSAKQGDTIPSGTIIRLQHMRTRKWLH
SHLHASPISGNLEVSCFGGESESDTGDYWRLIIEGSGKTWKQDQKIRLQHVDTGGYLHSH
DKKYARIAGGQQEVCGVREKRADNVWLAAEGVYLPVTKSK
Download sequence
Identical sequences A0A0B0NTT5
XP_017644784.1.75545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]