SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017656892.1.79516 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017656892.1.79516
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-55
Family YWTD domain 0.00000599
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-50
Family YWTD domain 0.00000259
Further Details:      
 
Domain Number 3 Region: 783-1040
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-38
Family YWTD domain 0.0000802
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-28
Family YWTD domain 0.0000814
Further Details:      
 
Domain Number 5 Region: 1171-1207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 1133-1169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1092-1132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 9 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000494
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 135-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000054
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000628
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017656892.1.79516
Sequence length 1451
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X1 [Nannospalax galili]; AA=GCF_000622305.1; RF=representative genome; TAX=1026970; STAX=1026970; NAME=Nannospalax galili; AL=Scaffold; RT=Major
Sequence
MYWTDWGETPRIERAGMDGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKQTGEKRKEILSALYSPMDI
QVLSQERQPPLHTRCEEDNGGCSHLCLLSPRDPFYTCACPTGVQLQDNGKTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGENPKIECANLDGRDRRVLVNTSLGWPNGLALDLQEGKLYWGDAKT
DKIEVINVDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQ
LPDLMGLKAVNVAKVVGTNPCADGNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIIPE
AFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTDCMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERMVVADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCAHSNGQCGQLCLAIPGGHRCSCASHYTLDPSSRNCSPP
STFLLFSQKFAISRMIPDDQRSPDLILPLHGLRNVRAIGYDPLDKFIYWVDGRQNIKRAK
DDGTQPSVLTSSGQSLSPDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGEAMGVVLRG
DRDKPRAIAVNAERGYLYFTNMQDHAAKIERAALDGTEREVLFTTGLIRPVALVVDNALG
KLFWVDADLKRIESCDLSGANRLTLEDSNIVQPVGLTVLGRHLYWIDRQQQMIERVEKTT
GDKRTRVQGRVTHLTGIHAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPAHL
VLLQNLLTCGEPPTCSPDQFTCATGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQFP
CARGQCVDLRLRCDGEADCQDRSDEANCDAVCLPNQFRCASGQCVLIKQQCDSFPDCADG
SDELLCEITNPPSDDTPAHSSAIGPIIGIILSLFVMGGVYFVCQRVMCQRYTGANGPFPH
EYVSGTPHVPLNFIAPGGSQHGPFPGISCSKSMMSSMNLVGGRGGVPLYDRNHVTGASSS
SSSSTKATLYPPILNPPPSPATDPSLYNMDMFYSSNIPATTRPYRPYIIRGMAPPTTPCS
TDVCDSDYSTSRWKTSKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLF
PPPPSPCTDSS
Download sequence
Identical sequences XP_008844525.1.79516 XP_017656892.1.79516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]