SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017658419.1.79516 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017658419.1.79516
Domain Number 1 Region: 28-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.62e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-33
Family Spectrin repeat 0.0000908
Further Details:      
 
Domain Number 3 Region: 2175-2294
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-33
Family Pleckstrin-homology domain (PH domain) 0.0000201
Further Details:      
 
Domain Number 4 Region: 601-741
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-29
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 1009-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 5.11e-29
Family Spectrin repeat 0.00000386
Further Details:      
 
Domain Number 6 Region: 1645-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 8.88e-29
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 7 Region: 1532-1687
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-27
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 1851-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-27
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 9 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-24
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 10 Region: 1228-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-24
Family Spectrin repeat 0.00072
Further Details:      
 
Domain Number 11 Region: 425-526
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-19
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 13 Region: 529-635
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-18
Family Spectrin repeat 0.00083
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000158
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 15 Region: 1386-1477
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000222
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017658419.1.79516
Sequence length 2331
Comment PREDICTED: spectrin beta chain, erythrocytic isoform X1 [Nannospalax galili]; AA=GCF_000622305.1; RF=representative genome; TAX=1026970; STAX=1026970; NAME=Nannospalax galili; AL=Scaffold; RT=Major
Sequence
MTSATEFENVSNQPPYSRINARWDGPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPTKGKMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFDV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTISVLNSRKFANSLSGVQQQLQAFSTYRTVEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRSELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVTQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVKA
LEDLAQELEKENYHDQKRIMARKDNILRLWSYLQELLRSRRQRLEATLALQKLFQDMLHS
IDWMDEIKAHILSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLQFTEGKGY
QPCDPQVIQERVSHLEQCFGELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLKQIFQEAEGMVARKQFGHPQIESRVKE
VSAQWDQLKELAAFRKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEHQAQGFPQEFHDSPDVTNRLQALRELYQQVMTQADLR
GQRLQDALDLYTVFGESDACELWMSEKEKWLNQMDTPDTLEDLEVVQHRFDILDQEMKTL
MAQIDGVNLAANNLVESGHPRSGEVKQYQDRLNKRWQAFQEVVSVRREAVDSALRVNNYC
VDCEETSKWIIDKTKVVESTKDLGQDLAGVIAIQRKLSGLERDVFAIQDRVGALERESQQ
LMESHPEQKEDIGRRQADVEKLWKGLQDALQGQELSLGEASKLQAFLQDLDEFQAWLSMA
QKAVASEDMPESLPEAEQLLQQHAAIKEEIDGHRDSYYQVKASGEKVIEGQKDPEYQLLG
QRLEGLDAGWDALRRMWESRGHSLTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
AAAEAGIRKFEDFLVSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHKKNN
EKAQEATVLLKDNLELQNFLQNCKELTLWINDKLLTSPDVSYDEARNLHNKWMKHQAFIA
ELASHQEWLENIDAEGRQLMAEKPQFKDVVSERLEALHKLWDELQTTTKEKTEQLSAARS
SDLRLQTHADLNKWIGAMEDQLRSDDLGKDLTTVNRMLAKLKRVEDQVNLRKEELEELFA
QAPLLGVEAGDTDMSIEKRFLDLLEPLGRRKKQLELSKAKLQISRDLEDETLWVEERLPL
AESPDYGTNLQTVQLFMKKNQTLQNEILGHAPRVEDVLQRGQQLVKAAEIDCQDIEERLG
HLQGSWDTLREAAAGRLQRLRDAHEAQQHYLDASEAEAWISEQELYVFSDELPKDEEGAI
VMLKRHLRQQRTVEEYGKNIKQLAIRAQSLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERRRKLENMYHLFQLKREADDLEQWITEKEMVASSQEMGQDFDHVTMLRDKFRDFARETG
AVGQERVDNVNAIIERLIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDLH
RYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVAT
RLQTAYAGEKADAIQSKEQEVSAAWQALLDACAGRRAQLVDTADKFRFFSMVRDLLSWME
SIIRQIETQERPRDVSSVELLLKYHQGIKAEINTRAKNFSTCLELGESLLQRQHQASEEI
REKLQQVMSRRREMDDKWEARSDRLHMLLEVCQFSRDASVAEAWLIAQEPYLASRDFGHT
VDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLELKERQTPERPTEESEHQEEEGETAG
EAPQVRRAATERTSPQGEERRLWPQYLHPPPLPGQHKDKQEEKSCGDERTVTEPLFKVLD
TPLSEGDEPTTLPAQRDLGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSELTF
YKDARNLALGVPYHGEEPLALRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEML
SWLQGMSTAINESQSIRVKAQSLPLPSLTGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_017658419.1.79516 XP_017658420.1.79516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]