SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017688345.1.3805 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017688345.1.3805
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-54
Family YWTD domain 0.00000163
Further Details:      
 
Domain Number 3 Region: 330-566
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-50
Family YWTD domain 0.00000346
Further Details:      
 
Domain Number 4 Region: 935-1194
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-40
Family YWTD domain 0.00004
Further Details:      
 
Domain Number 5 Region: 889-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1325-1363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1246-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000216
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1287-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000269
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1204-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000007
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017688345.1.3805
Sequence length 1612
Comment PREDICTED: low-density lipoprotein receptor-related protein 6 isoform X1 [Lepidothrix coronata]; AA=GCF_001604755.1; RF=representative genome; TAX=321398; STAX=321398; NAME=Lepidothrix coronata; AL=Scaffold; RT=Major
Sequence
MGPVLRSLLACSFCSLMRAAPLLLYANRRDLRLVDAANGKENATVIVGGLEDAAAVDFVF
VKGLIYWSDVSEEAIKRTEFNKSGSVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPGRGFMYWTDWGEVPKIERAGMDGSSRSIIVNTD
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDMLYWT
DWNTHSILACSKYSGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMS
PTKPSYQCACPTGVKLLENGKTCKDGATALLLLARRTDLRRISLDTPDFTDIVLPLEDIR
HAIAIDFDPLEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMAGYMYWTDWGEIPKIERSALDGSD
RIVLVNTSLGWPNGLALDYAESKMYWGDAKTDKIEVMNTDGTGRRVLVEDKLPHIFGFTL
LGDYIYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVRQIIGTNPCAEDNGGCS
HLCLYRPQGLRCACPIGLELINDMRTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNSDNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLS
IDIYSRYIYWTCEATNVINVTRVDGRPMGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPVALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNIQ
EYRQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDEKNCPVCSDTQFQCESGQCIDSALRCNGEANCQDNSDEK
NCEVLCLTDQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGV
ILTVFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTAATGKGYTSDLN
YDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences XP_017688345.1.3805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]