SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017749977.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017749977.1.44346
Domain Number 1 Region: 155-273
Classification Level Classification E-value
Superfamily DNA clamp 8.79e-18
Family DNA polymerase processivity factor 0.014
Further Details:      
 
Weak hits

Sequence:  XP_017749977.1.44346
Domain Number - Region: 28-100
Classification Level Classification E-value
Superfamily DNA clamp 0.00785
Family DNA polymerase processivity factor 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017749977.1.44346
Sequence length 280
Comment PREDICTED: cell cycle checkpoint protein RAD1 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAFIQAGIFQEFKVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLM
LFLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQIT
MSPDKPYFRLSTFGNAGSSHLDYPKDSDLMEAFHCNQTQVNRYKISLLKPSTKALVLSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES
Download sequence
Identical sequences A0A2K5K282 A0A2K5UF89 A0A2K5XN38 A0A2K6ASV8 A0A2K6LLQ0 A0A2K6NY44 F7A5K9
ENSPANP00000017773 9544.ENSMMUP00000000597 ENSMMUP00000000597 ENSMMUP00000000597 NP_001248089.1.72884 XP_005556758.1.63531 XP_010382394.1.97406 XP_010382395.1.97406 XP_011724961.1.29376 XP_011724962.1.29376 XP_011724963.1.29376 XP_011799724.1.43180 XP_011799725.1.43180 XP_011824504.1.47321 XP_011824505.1.47321 XP_014995289.1.72884 XP_017749977.1.44346 XP_017749978.1.44346 XP_017749979.1.44346 XP_017749981.1.44346 XP_017749982.1.44346 XP_017749983.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]