SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017758021.1.86738 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017758021.1.86738
Domain Number 1 Region: 1518-1772
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000438
Family Tropomyosin 0.00065
Further Details:      
 
Domain Number 2 Region: 1305-1531
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000392
Family Tropomyosin 0.0014
Further Details:      
 
Domain Number 3 Region: 372-615
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000265
Family Tropomyosin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017758021.1.86738
Sequence length 2184
Comment PREDICTED: myosin-2 heavy chain-like [Eufriesea mexicana]; AA=GCF_001483705.1; RF=representative genome; TAX=516756; STAX=516756; NAME=Eufriesea mexicana; AL=Scaffold; RT=Major
Sequence
MKEGQTADQQVSKVVERSIETLVDLSKSCGELRSENERLLAEAAELRGALARMKEEQLES
APLELEPMMRTIDTITVPEYVDISELLEKLKNCEDTVADLRKQLDDKDSLIDSLNKELET
MVSQMGLQEQIEAMAEELKRKDEKVPVESNITELLNTLRQSEIDLLGLSGLKSDLENLKP
ELQTLKLEKSELLDELSRLREALKDRNDQIIDILEQKDKLEREHHARLSALQSSLDEALA
GQTTLNQEIDDLKAQIANLTNELAQCNRRNEELEECCQDRDALAEKVLGLEDDLATARDT
VANLETEVETLRSDKEKLSEELDEARKQVELLTGELEDEMAARSTLQKDLGSARDEIEKL
QKENLDLRDQIEKLREALGESEKLAEENEKLRAQLEELRSENEGLTKRMGELDDLNNRLK
NEYDSMKQALGNLEAEVNRLEDELSRAVQERDALLNENNDIRGRLEQAIAENEALIARLD
EVAAQLDKLKLEKEELQMSLDEMGKENDLLKRDAKALRDDLEELKAAGDALRAADGDMKL
VLDKLERDMKDLKAERDRLTSENADLKSKISELEGKLAEAREKLEKATSENADLLKEVKR
LQGELEKALGDTEQLRLEVQSLTEGLDKCVDEMEKLMTENTELKSENEALKSEKDRLSDE
NADLKIKNLELQQRFDDITKELDKSKFENSDLLAEIDRLRNELEIALNNIEQLKSEIGSL
KEALDKCVGEMEKLKVENQDLKTENHQLETENHQLKTENNGLKTENQSLQSERDCLANEN
ADLKAMNSELQEKLENVAKELDKTKSENADLLGEINRLERELKEAWEDIDQLKSEMDSLK
EELDKCVGEIERLNAENNDLKSTNQDLKSEIQGIRGEGDSLAVELSKLKDENSVLKAERD
LLSKQLTDALAENEKLRMAKAELKAENEKLKEELDKCVDEMQRLNTKNNDLKSANQALNI
EIQGNKDELDSLIVELSKLKDENSVLKAERDQLSKQLTDALAENEKLRMAKAELKAENEK
LKEELDKCVDEMQRLNTENNDLKSANQALNIEIQGIKDELDSLIVELSKLKDENSVLKAE
RDQLSKQLTDALAENEKLRTAKAELEAEIEKLKEELDKCVNEIERLNTENNDLKSANQAL
KSEIQGLRGEGDSLAVELSKLKDENSVLKGERDQLSKQLTDALAENEKLRTAKAELEAEI
EKLKEELDKCVNEIERLNTENNDLKSANQALKSEIQGLRGEGDSLAVELSKLKDENSVLK
GERDQLSKQLTDALAENEKLRIAEAEFETENEKLKEELGECKGENDRLKDELDKLRDQLR
SLNDELDGLKGQLAEAEDKIRSLEPLVSSLQAENDKLRNDLAAVEDEARGLRTRVGREMD
DNERMRNDMKILEDQVQELSKKLDNVRAENEALKQENLALKERLAVAEGYLSDLKIECAD
LKSEIADLKKLIEELRAKIAQLEADVDHWKMENCKLQLEIDKLKADLEKALKDLSESQAL
RKAQEAELNRLQTEKADLHKKLADLSSEMDQQKRALGAEKSAKDKANSEISALKDELEAL
KKELEKLRGDNNKLRNEIDDLEKLLSATRKELNDAKEEIAALRNANSALRSELDALESLK
NEHDKLKTELEAVEAENASLREATKNLEDQYGKLRGEGDGQKLEIDTLRSNLDAEKAAAA
KLKSDLETCQAENDRLQAQLNELKKDLDKLRTENDRMKNEIDDLKKALADAEARVKSLEG
ELSDLLAEKEELVNELYRLRDELKNLKNDLQRQTTAKDAATKELADLKDELANLRAMLSK
SRDETETLKNENQKLTMDLDELNKLLEALRNENTKLRTENSDVTSKNEELTAELARVKDK
LKDAENNLNNLIKENKDLKNQIANLENVIKELEALKKQLEDAKKELDKLLPELDRLKLEK
AKLAEDLVKATNESSKLRGDLDKLKKDHEALQSELGGLKEEMERQKERDTAMEKELVRLK
KENDQLKNGNAKLKNELKDCQDENQRLRGELQDLKANNAKLHSDLSKAKNDADRLKGDLD
KLKSDYADLTTELANAREEKKRQKEHDSTLSADLAKMKKENNELKNANAKLKSQLYDCQK
ELENLKRENAKLKKAAGLITTTVAFRLFGLSLFKLDGEGSWSFDEVALQIRAERLMDGCL
IFASNDSLIGLGNIEGMKYCLIVN
Download sequence
Identical sequences XP_017758021.1.86738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]