SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017826040.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017826040.1.60252
Domain Number 1 Region: 2-541
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 4.84e-83
Family Acetyl-CoA synthetase-like 0.0000265
Further Details:      
 
Domain Number 2 Region: 753-1094
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.92e-49
Family Quinoprotein alcohol dehydrogenase-like 0.0091
Further Details:      
 
Domain Number 3 Region: 553-606
Classification Level Classification E-value
Superfamily ACP-like 0.0000131
Family Peptidyl carrier domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017826040.1.60252
Sequence length 1097
Comment PREDICTED: acyl-CoA synthetase family member 4 isoform X1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MTLQELVHKAASCYMDRVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIDPDSPPSLSTHFMKKCNLKYILVEKKQINKFK
SFHETLNYDTFTVEHNDLVLFRLHWKNTEVDLMLSDGKEKYEKEKIRNSVSSEHVNEEKV
EERMDLRLEHCLAYVLHTSGTTGIPKIVRVPHECIVPNIQHFRVLFDITQEDVLFLASPL
TFDPSVVEIFLALSSGASLLIVPTSIKLLPSKLATVLFSHHRVTVLQATPTLLRRFGSQL
IKSTVLSATTSLRVLALGGEVFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPE
KILNSTLKCELPVHLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDGEVTVPL
GTMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQE
KLILFMVSKDALVKDYIFKELQKHLPSHAIPDELVLIDTLPFTSHGKIDVSELNKIYLNY
INLKSENKLSGKEDLWEKLQYLWKSTLNLPDLLKVPDESRFLNSGGDSLKSMRLLSEIEK
LVGTLVPGLLEMILSSSILEIYNHILQTVFPDEDVTFRKSCATKRKLSNINQEEASGTSL
HQKAIMTLSCHNKINAFVALSRGSQILSLNTTRFLPKLGHCSSAYPSDSVSQTNTQNLKG
LNSPVLIGKSKDPSCVAKVPEEGKPAIGTQKMELHMRWRSDTGKCVDASPLVVIPSFDES
STTVYIGSHSHKMKAVDFYSGKVKWEQSLGDRIESSACVSKCGNFIVVGCYNGLVYVLKS
NSGEKYWMFTTEDTVKSSPTMDPTTGLIYIGSHDQHAYALDIYRKNCVWKSKCGGTVFSS
PCLNLIPHHLYCATLGGLLLAVNPATGNVIWKHSCGKPLFSSPRCCSQYICIGCVDGNLL
CFTHFGEQVWQFSTSGPIFSSPCTSPSEQKIFFGSHDCFIYCCNMKGHLQWKFETTSRVY
ATPFAFHNYNSSNEMLLAAASTDGKLWILESQSGQLQSVYELPGEVFSSPVVLESMLIIG
CRNNYVYCLDLLGGNQK
Download sequence
Identical sequences F6QFB5
ENSCJAP00000033460 ENSCJAP00000033475 XP_008991558.1.60252 XP_008991559.1.60252 XP_008991560.1.60252 XP_017826040.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]