SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017909555.1.57651 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017909555.1.57651
Domain Number 1 Region: 28-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.6e-92
Family Calponin-homology domain, CH-domain 0.00000306
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-33
Family Spectrin repeat 0.0000942
Further Details:      
 
Domain Number 3 Region: 2175-2294
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-33
Family Pleckstrin-homology domain (PH domain) 0.0000168
Further Details:      
 
Domain Number 4 Region: 1640-1793
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-29
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 1010-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-26
Family Spectrin repeat 0.00000577
Further Details:      
 
Domain Number 6 Region: 1850-2005
Classification Level Classification E-value
Superfamily Spectrin repeat 2.68e-26
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 815-950
Classification Level Classification E-value
Superfamily Spectrin repeat 4.54e-25
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 8 Region: 639-741
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-24
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 9 Region: 425-529
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-23
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 10 Region: 1532-1672
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-23
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 11 Region: 1229-1375
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-23
Family Spectrin repeat 0.00073
Further Details:      
 
Domain Number 12 Region: 745-849
Classification Level Classification E-value
Superfamily Spectrin repeat 4.89e-20
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 13 Region: 520-636
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-19
Family Spectrin repeat 0.00076
Further Details:      
 
Domain Number 14 Region: 2011-2070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000547
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 15 Region: 1389-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000236
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017909555.1.57651
Sequence length 2331
Comment PREDICTED: LOW QUALITY PROTEIN: spectrin beta chain, erythrocytic [Capra hircus]; AA=GCF_001704415.1; RF=representative genome; TAX=9925; STAX=9925; NAME=Capra hircus; breed=San Clemente; AL=Chromosome; RT=Major
Sequence
MTSATEFENVGNQPPYSRINARWDGPDDELDNDNSSARLFERSRIKALADEREVVQKKTF
TKWANSHLARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKAL
QFLREQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALL
LWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFEV
AERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIET
EKMIEKYSGLASDLLTWIEQTITVLNSRQFANSLAGVQQQLQAFSTYRTIEKPPKFQEKG
NLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRDELIRQEKL
EQLARRFDRKAAMRETWLNENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRA
LEDLAQELEQENYHDQKRITARKDNILRLWDYLQELLRARRQRLEKTLDLQKLFQDMLHS
IDWMDGIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITTATLQLAEGPGY
QPCDPQVIRDRVSHLEQCFEELSNTAAGRKAQLEQSKRLCKFFWEMDEAESWIKEKEQIY
SSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLGQIFREAEGMVARKQFGHEQIEVRIKK
VSDQWNELKDLAAFCKKNLQDTENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRA
LGKKHKDFLEELEESRGVMEHLEQQAQDFPQGFQDSPDVTNRLQALRDLYQQVVAQADMR
RQRLQDALDLYTVFGETDACELWMGEKGKWLAQMEIPDTLEDLEVVQHRFDILDQEMKTL
MTQIDGVNLAANSLVESNHPRSAEVKKCQDHLNTRWQDFQTMVSERREAVDSALRVHNYC
VDCEETGKWIMDKTKVVESTKDLGRDLAGVIAIQRKLSGLERDVAAIQTRLGTLERESQR
LMASHPEQKKDIEQRQAYVEELWQGLKQALKSQEASLGEASQLQAFLQDLDAFQAWLSTT
QKDVASKDMPESLPEAEQLLQQHAAIKDDIDRHQESYQKVRVSGEKVTHGQTDPEYLLLA
QRLDGLEKGWDALSRMWESRSQALTQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSL
EAAEAGIRKFEDFLVSMENNRDKVLSPVDSGNKLVAEGNLFSDKIKEKVQLIEDRHRKNN
EKALEASELLKDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVA
ELASHQGWLENIDAEGKQLMEEKPQFAALVSQKLEALHQLWDELQANTQETARQLSAARS
SDMRSQTQADLNKWIRAMEDQLQSDDLGKDLTSVNRMLAKLKRVEDQVNVRKEELEELFA
QMPSLGEEAGDEDLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPL
AQSTDYGTNLQTVQLFMKKNQTLQNEILGHTPRVEDVLHRGQQLVAAAEIDCQDVEERLG
QLQGSWDTLREAAASRLKHLQEASEAQQYYLDAGEXEAWIGEQEFYVFSDENPQDEESAI
VMLKRHLRQQRAVEEYGRNIKQLAGRAQGLLSAGHPEGEQIIRLQGQVDKQYAGLKDMAE
ERRRKLENMYHLFQLKREVDDLEQWIAEKDTVASSSEMGQDFDHVTVLRDKFRDFARETG
AIGQERVDNVNAIIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLQ
RYFYTGSEILGLIGEKHRELPEDVGLDASTAESFHRTHTAFERELHLLGEQVQQFQDVAA
RLQTAYAGEKADIIQNNEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWME
SIVRQIETQEKPRDVSSVELLMKYHQGIRAEIETRSKNFSTCLELGESLLQRQHQASDEI
REKREQVVSRREEMKEKWEARWERLRMLLEVCQFFRDASVAEAWLIAQEPYLASRDYGHT
VDGVEKLLKRHEAFEKSAASWEERFAALEKPTTLELKERQTPERTEEEPGLQEEEGETAG
EAPRGPHRATTERTSPGEEERPWPQDLQPPPPPGPHEDGQEEKSSTDERPATEPLFKVLD
TPLSEGDEPTTLPAQRDHGHSVQMEGFLGRKHDLEGPNKKASNRSWNNLYCVLRNSELAF
YKDAKNLALGVPYHGEEPLTLRHAICEIAANYKKKKHVFKLRLSNGSEWLFHGKDEEEML
SWLQGVSTAINESQSIRVKAQSLPLPPITGPDASLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences XP_017909555.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]