SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017921209.1.57651 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017921209.1.57651
Domain Number 1 Region: 164-312
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-45
Family Dual specificity phosphatase-like 0.00000243
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.06e-24
Family Cell cycle control phosphatase, catalytic domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017921209.1.57651
Sequence length 367
Comment PREDICTED: dual specificity protein phosphatase 1 [Capra hircus]; AA=GCF_001704415.1; RF=representative genome; TAX=9925; STAX=9925; NAME=Capra hircus; breed=San Clemente; AL=Chromosome; RT=Major
Sequence
MVMEVVSLDAGGLRTLLRERAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSAALDCAKRDGTLALAAGALCREARSAQIFL
LKGGYEAFSASYPELCSKQSTPMGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILPF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKNAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDCSTSTTTVFNFPVSIPVHPTNSALSYLQSP
ITTSPSC
Download sequence
Identical sequences F1MI99
ENSBTAP00000018411 ENSBTAP00000018411 XP_012009397.1.54773 XP_017921209.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]