SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017948939.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017948939.1.99540
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-54
Family YWTD domain 0.00000478
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-50
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-38
Family YWTD domain 0.0000643
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-29
Family YWTD domain 0.0000743
Further Details:      
 
Domain Number 5 Region: 1173-1208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 739-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000216
Family EGF-type module 0.023
Further Details:      
 
Domain Number 7 Region: 1094-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 8 Region: 1135-1171
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 437-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000945
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 10 Region: 134-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000682
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1052-1104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000117
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017948939.1.99540
Sequence length 1451
Comment PREDICTED: low-density lipoprotein receptor-related protein 5 isoform X2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MYWTDWGDTPRIERAGMDGSMRKVIVDTDIYWPNGLTIDLDEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLAGDTLYWTDWQTRSIHACNKRTGEKRREILSSLYSPMDI
QVFSKERQPYFPTPCDESNGGCSHLCLLSPREPFYSCTCPTGVQLTQDGKTCKTGADDVL
LLARRTDLRRISLDMPDFTDIVLQIDDIRHAIAIDYDPVEGYIYWTDDEVKAIRRAYLDG
SGAQTLVTTEVQHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAI
VLHPLTGYMYWTDWGENPKIESAYLDGSERMVLVNSSLGWPNGLALDLQDGKLYWGDAKT
DKIEVINVDGSNRKTLLEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKVRASREIIIDQ
LPDLMGLKAASVSNTFGTNPCADNNGGCSHLCFFSPRGVRCSCPIGLELLSDMRTCIIPE
AFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRLYWTDITLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWSDTGTNRIEVSRLDGLYRQVLVWKDLDNPR
SLALDPAKGYMYWTEWGGKPRIVRAYMDGTNSIILVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGAERVIIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKLNGNNRTLIQD
HLDFVMDILVFHSSRQDGLNDCMQNNGHCSQLCLAVPKGYKCSCSSHYTLDSNNRNCSPP
SNFLLFSQKTAINRMLLDEQQSPDITLPIHGLRNVKAVSYDPLDKLIYWVDGRQNIIKRA
KDDGTQPFVVVSTPNQSQTPEKQPHDLSIDIYSHTLYWTCEGTNTINANKLNGESIGVVL
RGDHDKPRAIAVNAERGYLYFTNMQERSPKIERAAFDGTEREVLFSTGLIRPVALVVDNK
LGKLFWVDADLKRIESSDLSGANRVTLEDSNILQPMGLTILGDHLYWIDKQQQMIERVEK
TNGIRRTKIQGRIAHPTGIHAVESVDMNEFSAHPCSRNNGGCSHICITKGDGTPRCSCPV
HLVLLQNLLTCGEPPTCSPEQFTCATGDIDCIPMAWRCDGFSECDDNSDEENCPVCSSNQ
FQCEKGQCIDARQKCNGEIDCQDKSDELDCDSICLPDQFRCANGQCIMMSQQCDTFPDCS
DSSDELICDKPPSEKTPSHSSAIGPVIGIILSVFVMGGLYFVCQRVVCHRYTGPNGPFPH
EYISGTPHVPLNFITTRSSQPNTYTGISYGKPMIGSMSIMGGSSGAPLYDRNHVTGASSS
SSSSTKATLYPQILNPPPSPATDRSLYNTEVFYSSNSPSTTRSYRPYLIRGIAPPTTPCS
TDVCDSDYTTSRWKANKYYMDLNSDSDPYPPPPTPRSQYMSAEESCPPSPTTERSYFHLY
PPPPSPCTDSS
Download sequence
Identical sequences XP_017948938.1.99540 XP_017948939.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]